Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nectin-2/CD112, Human (HEK293, Fc)

Nectin-2/CD112 protein has dual roles in T-cell signaling: as a costimulator with CD226, promoting proliferation and cytokine production, and as a coinhibitor with PVRIG, inhibiting proliferation. It also acts as a cell adhesion protein and a receptor for certain viruses. Nectin-2/CD112 Protein, Human (HEK293, Fc) is the recombinant human-derived Nectin-2/CD112 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Nectin-2/CD112 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nectin-2-cd112-protein-human-329a-a-hek293-fc.html

Purity

95.0

Smiles

QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGPL

Molecular Formula

5819 (Gene_ID) Q92692-2 /NP_002847.1 (Q32-L360) (Accession)

Molecular Weight

70-80 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTD012 CRISPR Activation Plasmid (h)
sc-417584-ACT 20 µg

PTD012 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
HEBP2 Double Nickase Plasmid (m2)
sc-424975-NIC-2 20 µg

HEBP2 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Rabbit Polyclonal Gigaxonin Antibody [DyLight 488]
NBP1-49923G 0.1 mL

Rabbit Polyclonal Gigaxonin Antibody [DyLight 488]

Sign In for Pricing
View Details
EREG Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
19416066 1.0 µg DNA

EREG Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
AZGP1 Protein Vector (Human) (pPM-C-His)
PV003332 500 ng

AZGP1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Phospho-Vimentin (Ser39) Antibody
MBS9614234-01 0.05 mL

Phospho-Vimentin (Ser39) Antibody

Sign In for Pricing
View Details