Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Decorin/PGS2, Human (HEK293, His)

Decorin/PGS2 Protein, Human (HEK 293, His) expresses in HEK293 with a His tag at the N-terminus. Decorin, an extracellular matrix (ECM) protein, belongs to the small leucine-rich proteoglycan family. Decorin acts as a ligand of various cytokines and growth factors by directly or indirectly interacting with the corresponding signalling molecules involved in cell growth, differentiation, proliferation, adhesion and metastasis[1].

Product Specifications

Product Name Alternative

Decorin/PGS2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/decorin-pgs2-protein-human-hek293-his.html

Purity

98.0

Smiles

GPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK

Molecular Formula

1634 (Gene_ID) P07585-1 (G17-K359) (Accession)

Molecular Weight

Approximately 42-55 kDa due to the glycosylation.

References & Citations

[1]Wen Zhang, et al. Decorin is a pivotal effector in the extracellular matrix and tumour microenvironment. Oncotarget. 2018 Jan 3;9 (4) :5480-5491.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin E Polyclonal Antibody
BT-AP01243-01 20 µL

Cathepsin E Polyclonal Antibody

Sign In for Pricing
View Details
Cathepsin E Polyclonal Antibody
BT-AP01243-02 50 µL

Cathepsin E Polyclonal Antibody

Sign In for Pricing
View Details
Cathepsin E Polyclonal Antibody
BT-AP01243-03 100 µL

Cathepsin E Polyclonal Antibody

Sign In for Pricing
View Details
N Cadherin Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-52389R-BF647-01 20 µL

N Cadherin Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
N Cadherin Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-52389R-BF647-02 100 µL

N Cadherin Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Pimethixene
E4862-100mg 100 mg

Pimethixene

Sign In for Pricing
View Details