Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G1B, Human (HEK293, His)

The PLA2G1B protein is a secreted calcium-dependent phospholipase A2 that targets dietary phospholipids in the intestine. It hydrolyzes the fatty acyl group at the sn-2 position, preferentially hydrolyzing phosphatidylethanolamine and phosphatidylglycerol. PLA2G1B Protein, Human (HEK293, His) is the recombinant human-derived PLA2G1B protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PLA2G1B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pla2g1b-protein-human-hek-293-his.html

Purity

98.0

Smiles

AVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS

Molecular Formula

5319 (Gene_ID) P04054 (A23-S148) (Accession)

Molecular Weight

17-20 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal BTLA/CD272 Antibody (2161A) [DyLight 594]
FAB33542M 0.1 mL

Rabbit Monoclonal BTLA/CD272 Antibody (2161A) [DyLight 594]

Sign In for Pricing
View Details
Rabbit Anti-ADO antibody
SL2640R-01 50 µL

Rabbit Anti-ADO antibody

Sign In for Pricing
View Details
Rabbit Anti-ADO antibody
SL2640R-02 100 µL

Rabbit Anti-ADO antibody

Sign In for Pricing
View Details
MCM2 (E-8) P
sc-373702 P 100 µg - 0.5 mL

MCM2 (E-8) P

Sign In for Pricing
View Details
Slc25a22 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4464702 1.0 µg DNA

Slc25a22 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Recombinant Human Ubiquitin-Conjugating Enzyme E2 K/UBE2K Protein (N-6His, SUMO tag)
MBS2553351-01 0.01 mg

Recombinant Human Ubiquitin-Conjugating Enzyme E2 K/UBE2K Protein (N-6His, SUMO tag)

Sign In for Pricing
View Details