Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Carbonic Anhydrase 10, Human (HEK293, His)

Carbonic Anhydrase 10 Protein, Human (HEK293, His) expresses in HEK293 cell with a His tag at the N-terminus. Carbonic anhydrase 10 is an inactive isoform of carbonic anhydrase (CAs) [1].

Product Specifications

Product Name Alternative

Carbonic Anhydrase 10 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/carbonic-anhydrase-10-protein-human-hek293-his.html

Purity

95.0

Smiles

QQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNHHHHHH

Molecular Formula

56934 (Gene_ID) Q9NS85-1 (Q22-N300) (Accession)

Molecular Weight

Approximately 34 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Ashok Aspatwar, et al. An update on carbonic anhydrase-related proteins VIII, X and XI. J Enzyme Inhib Med Chem. 2013 Dec;28 (6) :1129-42.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Transcription Factor EC (TFEC, TFE-C, TCFEC, Class E Basic Helix-loop-helix Protein 34, bHLHe34, Transcription Factor EC-like, TFECL, TFEC-L, hTFEC-L) (FITC)
MBS6150090-01 0.1 mL

Transcription Factor EC (TFEC, TFE-C, TCFEC, Class E Basic Helix-loop-helix Protein 34, bHLHe34, Transcription Factor EC-like, TFECL, TFEC-L, hTFEC-L) (FITC)

Ask
View Details
Transcription Factor EC (TFEC, TFE-C, TCFEC, Class E Basic Helix-loop-helix Protein 34, bHLHe34, Transcription Factor EC-like, TFECL, TFEC-L, hTFEC-L) (FITC)
MBS6150090-02 5x 0.1 mL

Transcription Factor EC (TFEC, TFE-C, TCFEC, Class E Basic Helix-loop-helix Protein 34, bHLHe34, Transcription Factor EC-like, TFECL, TFEC-L, hTFEC-L) (FITC)

Ask
View Details
PBK, 1-322aa, Human, His tag, E Coli
MBS204644-01 0.02 mg

PBK, 1-322aa, Human, His tag, E Coli

Ask
View Details
PBK, 1-322aa, Human, His tag, E Coli
MBS204644-02 0.1 mg

PBK, 1-322aa, Human, His tag, E Coli

Ask
View Details
PBK, 1-322aa, Human, His tag, E Coli
MBS204644-03 5x 0.02 mg

PBK, 1-322aa, Human, His tag, E Coli

Ask
View Details
PBK, 1-322aa, Human, His tag, E Coli
MBS204644-04 0.5 mg

PBK, 1-322aa, Human, His tag, E Coli

Ask
View Details