Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free FGF-12, Human (His)

FGF-12, vital for nervous system development, positively regulates voltage-gated sodium channels, particularly SCN8A, enhancing neuronal excitability. It achieves this by elevating the voltage dependence of SCN8A fast inactivation. FGF-12 interacts specifically with the C-terminal region of SCN9A. Animal-Free FGF-12 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-12 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free FGF-12 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-fgf-12-protein-human-his.html

Purity

95.0

Smiles

MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Molecular Formula

2257 (Gene_ID) P61328-2 (M1-T181) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR2116 Human qPCR Primer Pair (MI0010635)
HP300705 200 Reactions

MIR2116 Human qPCR Primer Pair (MI0010635)

Sign In for Pricing
View Details
MK-0752
C16979-200mg 200 mg

MK-0752

Sign In for Pricing
View Details
VPS35 Human Over-expression Lysate
orb1356682 100 µg

VPS35 Human Over-expression Lysate

Sign In for Pricing
View Details
Human ATP12A siRNA
abx900510-01 15 nmol

Human ATP12A siRNA

Sign In for Pricing
View Details
Human ATP12A siRNA
abx900510-02 30 nmol

Human ATP12A siRNA

Sign In for Pricing
View Details
Recombinant Human Synaptic vesicle glycoprotein 2C (SV2C), partial
CSB-YP002980HU-01 20 µg

Recombinant Human Synaptic vesicle glycoprotein 2C (SV2C), partial

Sign In for Pricing
View Details