Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD320 antigen (CD320), partial

Product Specifications

Product Name Alternative

8D6 antigenFDC-signaling molecule 8D6 ; FDC-SM-8D6Transcobalamin receptor ; TCblR; ; CD320

Abbreviation

Recombinant Human CD320 protein, partial

Gene Name

CD320

UniProt

Q9NPF0

Expression Region

36-231aa

Organism

Homo sapiens (Human)

Target Sequence

SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGV

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Germinal center-B (GC-B) cells differentiate into mory B-cells and plasma cells (PC) through interaction with T-cells and follicular dendritic cells (FDC) . CD320 augments the proliferation of PC precursors generated by IL-10. Receptor for the cellular uptake of transcobalamin bound cobalamin.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Receptor for transcobalamin saturated with cobalamin (TCbl)

Molecular Weight

47.6 kDa

References & Citations

Identification of a human follicular dendritic cell molecule that stimulates germinal center B cell growth.Li L., Zhang X., Kovacic S., Long A.J., Bourque K., Wood C.R., Choi Y.S.J. Exp. Med. 191:1077-1084 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAZRICHE450X52RL-T1-LL-P2 Pipe Markers for Gases
N000720 30 Pack (30 Marker (s) x 1 Roll)

GAZRICHE450X52RL-T1-LL-P2 Pipe Markers for Gases

Sign In for Pricing
View Details
Lin28B Antibody (YA709, Mouse)
HY-P80211-01 10 µL

Lin28B Antibody (YA709, Mouse)

Sign In for Pricing
View Details
Lin28B Antibody (YA709, Mouse)
HY-P80211-02 50 μL

Lin28B Antibody (YA709, Mouse)

Sign In for Pricing
View Details
Lin28B Antibody (YA709, Mouse)
HY-P80211-03 100 µL

Lin28B Antibody (YA709, Mouse)

Sign In for Pricing
View Details
CD274 (B7-h1 Protein, B7-H1, B7H1, MGC142294, MGC142296, PD-L1, PDCD1L1, PDCD1LG1, PDL1) (Biotin)
MBS6468293-01 0.1 mL

CD274 (B7-h1 Protein, B7-H1, B7H1, MGC142294, MGC142296, PD-L1, PDCD1L1, PDCD1LG1, PDL1) (Biotin)

Sign In for Pricing
View Details
CD274 (B7-h1 Protein, B7-H1, B7H1, MGC142294, MGC142296, PD-L1, PDCD1L1, PDCD1LG1, PDL1) (Biotin)
MBS6468293-02 5x 0.1 mL

CD274 (B7-h1 Protein, B7-H1, B7H1, MGC142294, MGC142296, PD-L1, PDCD1L1, PDCD1LG1, PDL1) (Biotin)

Sign In for Pricing
View Details