Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Leptin, Rat

Leptin Protein, Rat is a hormone secreted by fat cells that helps to regulate energy balance by inhibiting feeding and increase thermogenesis.

Product Specifications

Product Name Alternative

Leptin Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/leptin-protein-rat.html

Purity

97.00

Smiles

VPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC

Molecular Formula

25608 (Gene_ID) P50596 (V22-C167) (Accession)

Molecular Weight

Approximately 16.3 kDa

References & Citations

[1]Jéquier E, et al. Leptin signaling, adiposity, and energy balance. Ann N Y Acad Sci. 2002 Jun;967:379-88.|[2]Friedman JM, et al. Leptin and the regulation of body weigh. Keio J Med. 2011;60 (1) :1-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PCDH10 shRNA (UAS) - Lentiviral human PCDH10 shRNA (UAS, GFP) plasmid
GTR15083734 1 Vial

Lentiviral human PCDH10 shRNA (UAS) - Lentiviral human PCDH10 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
SELL Recombinant Monoclonal Antibody
CSB-RA020977MA1HU-01 50 μL

SELL Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
SELL Recombinant Monoclonal Antibody
CSB-RA020977MA1HU-02 100 µL

SELL Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
RRM1 (Ribonucleotide Reductase M1, R1, RIR1, RR1) (MaxLight 405) discontinued
251306-ML405 100 µL

RRM1 (Ribonucleotide Reductase M1, R1, RIR1, RR1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Polyclonal Antibody to High Mobility Group Protein 1 (HMGB1)
TRV-0056047-01 20 µL

Polyclonal Antibody to High Mobility Group Protein 1 (HMGB1)

Sign In for Pricing
View Details
Polyclonal Antibody to High Mobility Group Protein 1 (HMGB1)
TRV-0056047-02 100 µL

Polyclonal Antibody to High Mobility Group Protein 1 (HMGB1)

Sign In for Pricing
View Details