Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Leptin, Rat

Leptin Protein, Rat is a hormone secreted by fat cells that helps to regulate energy balance by inhibiting feeding and increase thermogenesis.

Product Specifications

Product Name Alternative

Leptin Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/leptin-protein-rat.html

Purity

97.00

Smiles

VPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC

Molecular Formula

25608 (Gene_ID) P50596 (V22-C167) (Accession)

Molecular Weight

Approximately 16.3 kDa

References & Citations

[1]Jéquier E, et al. Leptin signaling, adiposity, and energy balance. Ann N Y Acad Sci. 2002 Jun;967:379-88.|[2]Friedman JM, et al. Leptin and the regulation of body weigh. Keio J Med. 2011;60 (1) :1-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CNDP1 Protein (His tag)
ARP6779-01 10 µg

Recombinant Mouse CNDP1 Protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse CNDP1 Protein (His tag)
ARP6779-02 50 µg

Recombinant Mouse CNDP1 Protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse CNDP1 Protein (His tag)
ARP6779-03 100 µg

Recombinant Mouse CNDP1 Protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse CNDP1 Protein (His tag)
ARP6779-04 1 mg

Recombinant Mouse CNDP1 Protein (His tag)

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 3 alpha (MIP-3-alpha, MIP3A, MIP-3a, Beta Chemokine Exodus-1, CC Chemokine LARC, C-C Motif Chemokine 20, Chemokine (C-C Motif) Ligand 20, CCL20, CKb4, Liver and Activation-regulated Chemokine, LARC, Small-inducible Cytokine A20, SCYA20, ST38) (PE)
M1202-60K-PE 100 µL

Macrophage Inflammatory Protein 3 alpha (MIP-3-alpha, MIP3A, MIP-3a, Beta Chemokine Exodus-1, CC Chemokine LARC, C-C Motif Chemokine 20, Chemokine (C-C Motif) Ligand 20, CCL20, CKb4, Liver and Activation-regulated Chemokine, LARC, Small-inducible Cytokine A20, SCYA20, ST38) (PE)

Sign In for Pricing
View Details
Human IL2Ra (Interleukin 2 Receptor Alpha) ELISA Kit
MBS8801179-01 48 Well

Human IL2Ra (Interleukin 2 Receptor Alpha) ELISA Kit

Sign In for Pricing
View Details