Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Leptin, Rat

Leptin Protein, Rat is a hormone secreted by fat cells that helps to regulate energy balance by inhibiting feeding and increase thermogenesis.

Product Specifications

Product Name Alternative

Leptin Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/leptin-protein-rat.html

Purity

97.00

Smiles

VPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC

Molecular Formula

25608 (Gene_ID) P50596 (V22-C167) (Accession)

Molecular Weight

Approximately 16.3 kDa

References & Citations

[1]Jéquier E, et al. Leptin signaling, adiposity, and energy balance. Ann N Y Acad Sci. 2002 Jun;967:379-88.|[2]Friedman JM, et al. Leptin and the regulation of body weigh. Keio J Med. 2011;60 (1) :1-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r79 Mouse Gene Knockout Kit (CRISPR)
KN519095 1 Kit

Vmn1r79 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MHCG Polyclonal Antibody
E-AB-40663-01 25 µL

MHCG Polyclonal Antibody

Sign In for Pricing
View Details
MHCG Polyclonal Antibody
E-AB-40663-02 100 µL

MHCG Polyclonal Antibody

Sign In for Pricing
View Details
Zfp513 Mouse Gene Knockout Kit (CRISPR)
KN519862 1 Kit

Zfp513 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LAMP1 Recombinant Rabbit monoclonal Antibody
HA751017 100 µL

LAMP1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
G protein alpha 16 (GNA15) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6B3]
TA808136AM 100 µL

G protein alpha 16 (GNA15) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6B3]

Sign In for Pricing
View Details