Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Leptin, Rat

Leptin Protein, Rat is a hormone secreted by fat cells that helps to regulate energy balance by inhibiting feeding and increase thermogenesis.

Product Specifications

Product Name Alternative

Leptin Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/leptin-protein-rat.html

Purity

97.00

Smiles

VPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC

Molecular Formula

25608 (Gene_ID) P50596 (V22-C167) (Accession)

Molecular Weight

Approximately 16.3 kDa

References & Citations

[1]Jéquier E, et al. Leptin signaling, adiposity, and energy balance. Ann N Y Acad Sci. 2002 Jun;967:379-88.|[2]Friedman JM, et al. Leptin and the regulation of body weigh. Keio J Med. 2011;60 (1) :1-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-INSM2 Antibody Picoband®, PE Conjugate
A14973-1-PE 100 µg/Vial

Anti-INSM2 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
LHX9 (LIM Homeobox 9)
248182 100 µg

LHX9 (LIM Homeobox 9)

Sign In for Pricing
View Details
Recombinant Human VEGFA Protein, C-His
orb2969098-01 50 µg

Recombinant Human VEGFA Protein, C-His

Sign In for Pricing
View Details
Recombinant Human VEGFA Protein, C-His
orb2969098-02 100 µg

Recombinant Human VEGFA Protein, C-His

Sign In for Pricing
View Details
Recombinant Human VEGFA Protein, C-His
orb2969098-03 1 mg

Recombinant Human VEGFA Protein, C-His

Sign In for Pricing
View Details
ARRY-382
T35333-01 1 mg

ARRY-382

Sign In for Pricing
View Details