Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1F10/IL-38, Human

IL-1F10/IL-38 Protein is a member of the interleukin 1 cytokine family that regulates adapted and innate immune responses[1]. IL-1F10/IL-38 Protein, Human is the recombinant human-derived IL-1F10/IL-38 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-1F10/IL-38 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1f10-il-38-protein-human.html

Purity

95.0

Smiles

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Molecular Formula

84639 (Gene_ID) AAI03967.1 (M1-W152) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dog/Canine Brucella Ab IgG BAL ELISA Kit
BG-CAN10403 1 Each

Dog/Canine Brucella Ab IgG BAL ELISA Kit

Sign In for Pricing
View Details
GSR (Glutathione Reductase, Mitochondrial, GR, GRase, GSR, GLUR, GRD1, MGC78522) (Biotin)
MBS6380343-01 0.1 mL

GSR (Glutathione Reductase, Mitochondrial, GR, GRase, GSR, GLUR, GRD1, MGC78522) (Biotin)

Sign In for Pricing
View Details
GSR (Glutathione Reductase, Mitochondrial, GR, GRase, GSR, GLUR, GRD1, MGC78522) (Biotin)
MBS6380343-02 5x 0.1 mL

GSR (Glutathione Reductase, Mitochondrial, GR, GRase, GSR, GLUR, GRD1, MGC78522) (Biotin)

Sign In for Pricing
View Details
PRAF2 Protein Lysate (Mouse) with C-HA Tag
37522034 100 µg

PRAF2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Recombinant Human STX1A Protein, His, E.coli-25ug
QP13632-25ug 25ug

Recombinant Human STX1A Protein, His, E.coli-25ug

Sign In for Pricing
View Details
Bovine Immunoglobulin gamma2 Chain C Region ELISA Kit
MBS7263832-01 48 Well

Bovine Immunoglobulin gamma2 Chain C Region ELISA Kit

Sign In for Pricing
View Details