IL-1F10/IL-38, Human
IL-1F10/IL-38 Protein is a member of the interleukin 1 cytokine family that regulates adapted and innate immune responses[1]. IL-1F10/IL-38 Protein, Human is the recombinant human-derived IL-1F10/IL-38 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
IL-1F10/IL-38 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-1f10-il-38-protein-human.html
Purity
95.0
Smiles
MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW
Molecular Formula
84639 (Gene_ID) AAI03967.1 (M1-W152) (Accession)
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
![HDHD2 Mouse Monoclonal Antibody [Clone ID: OTI2E11]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
TA502916S 30 µL
HDHD2 Mouse Monoclonal Antibody [Clone ID: OTI2E11]
Sign In for Pricing
View Details ![Rabbit Polyclonal CLPTM1 Antibody [DyLight 594]](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
NBP2-32114DL594 0.1 mL
Rabbit Polyclonal CLPTM1 Antibody [DyLight 594]
Sign In for Pricing
View Details ![Rabbit Polyclonal Transaldolase 1 Antibody [CoraFluor 1]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
NBP2-32217CL1 0.1 mL
Rabbit Polyclonal Transaldolase 1 Antibody [CoraFluor 1]
Sign In for Pricing
View Details K2235305 3x 1.0 µg
SNORD96B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details GTR15365348 1 Vial
Lentiviral human TRIM11 sgRNA gene knockout kit - Lentiviral human TRIM11 sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details