Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1F10/IL-38, Human

IL-1F10/IL-38 Protein is a member of the interleukin 1 cytokine family that regulates adapted and innate immune responses[1]. IL-1F10/IL-38 Protein, Human is the recombinant human-derived IL-1F10/IL-38 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-1F10/IL-38 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1f10-il-38-protein-human.html

Purity

95.0

Smiles

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Molecular Formula

84639 (Gene_ID) AAI03967.1 (M1-W152) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDH7 Mouse Monoclonal Antibody [Clone ID: LBI1G8]
AMM13184V 100 µL

PCDH7 Mouse Monoclonal Antibody [Clone ID: LBI1G8]

Sign In for Pricing
View Details
Recombinant Human TSLP
MBS4159731-01 0.01 mg

Recombinant Human TSLP

Sign In for Pricing
View Details
Recombinant Human TSLP
MBS4159731-02 0.1 mg

Recombinant Human TSLP

Sign In for Pricing
View Details
Recombinant Human TSLP
MBS4159731-03 1 mg

Recombinant Human TSLP

Sign In for Pricing
View Details
Recombinant Human TSLP
MBS4159731-04 5x 1 mg

Recombinant Human TSLP

Sign In for Pricing
View Details
Cct2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4936206 1.0 µg DNA

Cct2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details