Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1F10/IL-38, Human

IL-1F10/IL-38 Protein is a member of the interleukin 1 cytokine family that regulates adapted and innate immune responses[1]. IL-1F10/IL-38 Protein, Human is the recombinant human-derived IL-1F10/IL-38 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-1F10/IL-38 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1f10-il-38-protein-human.html

Purity

95.0

Smiles

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Molecular Formula

84639 (Gene_ID) AAI03967.1 (M1-W152) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABA Receptor A, alpha 1 (Gamma-aminobutyric Acid Receptor Type A alpha 1 Subunit, GABRA1)
G1015-06 200 µL

GABA Receptor A, alpha 1 (Gamma-aminobutyric Acid Receptor Type A alpha 1 Subunit, GABRA1)

Sign In for Pricing
View Details
DEFA4 sgRNA CRISPR Lentivector (Human) (Target 2)
K0576903 1.0 µg DNA

DEFA4 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal TMEM18 Antibody [DyLight 488]
NBP2-81843G 0.1 mL

Rabbit Polyclonal TMEM18 Antibody [DyLight 488]

Sign In for Pricing
View Details
CD94 (CD94 Antigen, Killer Cell Lectin-like Receptor Subfamily D Member 1, KLRD1, KLRD1 Protein, Kp43, Natural Killer Cells Antigen CD94, NK Cell Receptor) (MaxLight 750)
MBS6256857-01 0.1 mL

CD94 (CD94 Antigen, Killer Cell Lectin-like Receptor Subfamily D Member 1, KLRD1, KLRD1 Protein, Kp43, Natural Killer Cells Antigen CD94, NK Cell Receptor) (MaxLight 750)

Sign In for Pricing
View Details
CD94 (CD94 Antigen, Killer Cell Lectin-like Receptor Subfamily D Member 1, KLRD1, KLRD1 Protein, Kp43, Natural Killer Cells Antigen CD94, NK Cell Receptor) (MaxLight 750)
MBS6256857-02 5x 0.1 mL

CD94 (CD94 Antigen, Killer Cell Lectin-like Receptor Subfamily D Member 1, KLRD1, KLRD1 Protein, Kp43, Natural Killer Cells Antigen CD94, NK Cell Receptor) (MaxLight 750)

Sign In for Pricing
View Details
KATNAL2 Human shRNA Plasmid Kit (Locus ID 83473)
TR303845 1 Kit

KATNAL2 Human shRNA Plasmid Kit (Locus ID 83473)

Sign In for Pricing
View Details