Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1F10/IL-38, Human

IL-1F10/IL-38 Protein is a member of the interleukin 1 cytokine family that regulates adapted and innate immune responses[1]. IL-1F10/IL-38 Protein, Human is the recombinant human-derived IL-1F10/IL-38 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-1F10/IL-38 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1f10-il-38-protein-human.html

Purity

95.0

Smiles

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Molecular Formula

84639 (Gene_ID) AAI03967.1 (M1-W152) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klk5 (NM_026806) Mouse Tagged ORF Clone
MG221193 10 µg

Klk5 (NM_026806) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human MYOM1 siRNA
abx925245-01 15 nmol

Human MYOM1 siRNA

Sign In for Pricing
View Details
Human MYOM1 siRNA
abx925245-02 30 nmol

Human MYOM1 siRNA

Sign In for Pricing
View Details
Fish Roundabout Homolog 2 (ROBO2) ELISA Kit
MBS9359343 Inquire

Fish Roundabout Homolog 2 (ROBO2) ELISA Kit

Sign In for Pricing
View Details
BMP-8a Protein (C-His, Human)
P513516 100 µg

BMP-8a Protein (C-His, Human)

Sign In for Pricing
View Details
Human COUP transcription factor 2 (NR2F2) ELISA Kit
YP-W17069-01 48 Tests

Human COUP transcription factor 2 (NR2F2) ELISA Kit

Sign In for Pricing
View Details