Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1F10/IL-38, Human

IL-1F10/IL-38 Protein is a member of the interleukin 1 cytokine family that regulates adapted and innate immune responses[1]. IL-1F10/IL-38 Protein, Human is the recombinant human-derived IL-1F10/IL-38 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-1F10/IL-38 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1f10-il-38-protein-human.html

Purity

95.0

Smiles

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Molecular Formula

84639 (Gene_ID) AAI03967.1 (M1-W152) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR14C36, CT (OR14C36, OR5BF1, Olfactory receptor 14C36, Olfactory receptor 5BF1, Olfactory receptor OR1-59) (MaxLight 490)
MBS6328135-01 0.1 mL

OR14C36, CT (OR14C36, OR5BF1, Olfactory receptor 14C36, Olfactory receptor 5BF1, Olfactory receptor OR1-59) (MaxLight 490)

Sign In for Pricing
View Details
OR14C36, CT (OR14C36, OR5BF1, Olfactory receptor 14C36, Olfactory receptor 5BF1, Olfactory receptor OR1-59) (MaxLight 490)
MBS6328135-02 5x 0.1 mL

OR14C36, CT (OR14C36, OR5BF1, Olfactory receptor 14C36, Olfactory receptor 5BF1, Olfactory receptor OR1-59) (MaxLight 490)

Sign In for Pricing
View Details
Exo1 Double Nickase Plasmid (h)
sc-402356-NIC 20 µg

Exo1 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Idarubicin hydrochloride
M15119-01 1 g

Idarubicin hydrochloride

Sign In for Pricing
View Details
Idarubicin hydrochloride
M15119-02 100 mg

Idarubicin hydrochloride

Sign In for Pricing
View Details
Idarubicin hydrochloride
M15119-03 200 mg

Idarubicin hydrochloride

Sign In for Pricing
View Details