Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1F10/IL-38, Human

IL-1F10/IL-38 Protein is a member of the interleukin 1 cytokine family that regulates adapted and innate immune responses[1]. IL-1F10/IL-38 Protein, Human is the recombinant human-derived IL-1F10/IL-38 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-1F10/IL-38 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1f10-il-38-protein-human.html

Purity

95.0

Smiles

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Molecular Formula

84639 (Gene_ID) AAI03967.1 (M1-W152) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Stk10 shRNA (UAS) - Lentiviral mouse Stk10 shRNA (UAS, iRFP) plasmid
GTR15105784 1 Vial

Lentiviral mouse Stk10 shRNA (UAS) - Lentiviral mouse Stk10 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Human MIR4741 qPCR Primer Pair
QH84805S 200 Tests

Human MIR4741 qPCR Primer Pair

Sign In for Pricing
View Details
Elavl4 (NM_001077651) Rat Tagged ORF Clone Lentiviral Particle
RR206728L3V 200 µL

Elavl4 (NM_001077651) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Monkeypox virus/MPXV M1R Recombinant Protein
PPT-16245 100 µg

Monkeypox virus/MPXV M1R Recombinant Protein

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain 8739/DSM 1576/Crooks) NADE Polyclonal Antibody
MBS7184414 Inquire

Rabbit anti-Escherichia coli (strain 8739/DSM 1576/Crooks) NADE Polyclonal Antibody

Sign In for Pricing
View Details
NTAL (F-9) Alexa Fluor® 790
sc-398825 AF790 200 µg/mL

NTAL (F-9) Alexa Fluor® 790

Sign In for Pricing
View Details