Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1F10/IL-38, Human

IL-1F10/IL-38 Protein is a member of the interleukin 1 cytokine family that regulates adapted and innate immune responses[1]. IL-1F10/IL-38 Protein, Human is the recombinant human-derived IL-1F10/IL-38 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-1F10/IL-38 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1f10-il-38-protein-human.html

Purity

95.0

Smiles

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Molecular Formula

84639 (Gene_ID) AAI03967.1 (M1-W152) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SARS-CoV-2 Envelope Antibody [CoraFluor 1]
NBP2-41061CL1 0.1 mL

Rabbit Polyclonal SARS-CoV-2 Envelope Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Lvrn (NM_029008) Mouse Tagged Lenti ORF Clone
MR218789L3 10 µg

Lvrn (NM_029008) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
pEnCMV-IL2RG-3XFLAG Plasmid
PVT32651 2 µg

pEnCMV-IL2RG-3XFLAG Plasmid

Sign In for Pricing
View Details
ADRB2 (Beta-2 Adrenergic Receptor, ADRB2R, ADRBR, B2AR, BAR, BETA2AR) (MaxLight 405)
MBS6405700-01 0.1 mL

ADRB2 (Beta-2 Adrenergic Receptor, ADRB2R, ADRBR, B2AR, BAR, BETA2AR) (MaxLight 405)

Sign In for Pricing
View Details
ADRB2 (Beta-2 Adrenergic Receptor, ADRB2R, ADRBR, B2AR, BAR, BETA2AR) (MaxLight 405)
MBS6405700-02 5x 0.1 mL

ADRB2 (Beta-2 Adrenergic Receptor, ADRB2R, ADRBR, B2AR, BAR, BETA2AR) (MaxLight 405)

Sign In for Pricing
View Details
KITLG (KIT Ligand, DKFZp686F2250, KL-1, Kitl, MGF, SCF, SF, SHEP7) (PE)
MBS6184986-01 0.1 mL

KITLG (KIT Ligand, DKFZp686F2250, KL-1, Kitl, MGF, SCF, SF, SHEP7) (PE)

Sign In for Pricing
View Details