Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1F10/IL-38, Human

IL-1F10/IL-38 Protein is a member of the interleukin 1 cytokine family that regulates adapted and innate immune responses[1]. IL-1F10/IL-38 Protein, Human is the recombinant human-derived IL-1F10/IL-38 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-1F10/IL-38 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1f10-il-38-protein-human.html

Purity

95.0

Smiles

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Molecular Formula

84639 (Gene_ID) AAI03967.1 (M1-W152) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Usmg5 AAV siRNA Pooled Vector
49268166 1.0 µg

Usmg5 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Cav Beta 4 (CAB4) Antibody
abx444973 100 µg

Cav Beta 4 (CAB4) Antibody

Sign In for Pricing
View Details
Porcine Bravo Chlorothalonil ELISA Kit
EIA07571p 1 Kit

Porcine Bravo Chlorothalonil ELISA Kit

Sign In for Pricing
View Details
Porcine Leptin Receptor (LEPR) ELISA Kit
EIA05957p 1 Kit

Porcine Leptin Receptor (LEPR) ELISA Kit

Sign In for Pricing
View Details
Human NRM shRNA Plasmid
abx957726-01 150 µg

Human NRM shRNA Plasmid

Sign In for Pricing
View Details
Human NRM shRNA Plasmid
abx957726-02 300 µg

Human NRM shRNA Plasmid

Sign In for Pricing
View Details