IL-1F10/IL-38, Human
IL-1F10/IL-38 Protein is a member of the interleukin 1 cytokine family that regulates adapted and innate immune responses[1]. IL-1F10/IL-38 Protein, Human is the recombinant human-derived IL-1F10/IL-38 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
IL-1F10/IL-38 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-1f10-il-38-protein-human.html
Purity
95.0
Smiles
MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW
Molecular Formula
84639 (Gene_ID) AAI03967.1 (M1-W152) (Accession)
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6337969-01 0.1 mL
PRSS7, CT (E979) (TMPRSS15, ENTK, PRSS7, Enteropeptidase, Enterokinase, Serine protease 7, Transmembrane protease serine 15, Enteropeptidase non-catalytic heavy chain, Enteropeptidase catalytic light chain) (MaxLight 490)
Sign In for Pricing
View Details 
MBS6337969-02 5x 0.1 mL
PRSS7, CT (E979) (TMPRSS15, ENTK, PRSS7, Enteropeptidase, Enterokinase, Serine protease 7, Transmembrane protease serine 15, Enteropeptidase non-catalytic heavy chain, Enteropeptidase catalytic light chain) (MaxLight 490)
Sign In for Pricing
View Details 
MBS9938241 Inquire
Donkey Eukaryotic Translation Initiation Factor 4 Gamma 3 (EIF4G3) ELISA Kit
Sign In for Pricing
View Details