Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1F10/IL-38, Human

IL-1F10/IL-38 Protein is a member of the interleukin 1 cytokine family that regulates adapted and innate immune responses[1]. IL-1F10/IL-38 Protein, Human is the recombinant human-derived IL-1F10/IL-38 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-1F10/IL-38 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1f10-il-38-protein-human.html

Purity

95.0

Smiles

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Molecular Formula

84639 (Gene_ID) AAI03967.1 (M1-W152) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPMT Human shRNA Lentiviral Particle (Locus ID 7172)
TL315046V 500 µL Each

TPMT Human shRNA Lentiviral Particle (Locus ID 7172)

Sign In for Pricing
View Details
CoA, lithiumsalt
MF-0128724-01 10 mg

CoA, lithiumsalt

Sign In for Pricing
View Details
CoA, lithiumsalt
MF-0128724-02 50 mg

CoA, lithiumsalt

Sign In for Pricing
View Details
LTBR Mouse Monoclonal Antibody [Clone ID: OTI3G10]
CF805712 100 µg

LTBR Mouse Monoclonal Antibody [Clone ID: OTI3G10]

Sign In for Pricing
View Details
Mouse Olfr1329 activation kit by CRISPRa
GA215453 1 Kit

Mouse Olfr1329 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Monoclonal Smad5 Antibody (4F10)
H00004090-M05 0.1 mg

Mouse Monoclonal Smad5 Antibody (4F10)

Sign In for Pricing
View Details