IL-1F10/IL-38, Human
IL-1F10/IL-38 Protein is a member of the interleukin 1 cytokine family that regulates adapted and innate immune responses[1]. IL-1F10/IL-38 Protein, Human is the recombinant human-derived IL-1F10/IL-38 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
IL-1F10/IL-38 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-1f10-il-38-protein-human.html
Purity
95.0
Smiles
MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW
Molecular Formula
84639 (Gene_ID) AAI03967.1 (M1-W152) (Accession)
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9912266-01 48 Well
Mouse Glucosamine-6-Phosphate Isomerase 2 (GNPDA2) ELISA Kit
Sign In for Pricing
View Details MBS9912266-02 96 Well
Mouse Glucosamine-6-Phosphate Isomerase 2 (GNPDA2) ELISA Kit
Sign In for Pricing
View Details MBS9912266-03 5x 96 Well
Mouse Glucosamine-6-Phosphate Isomerase 2 (GNPDA2) ELISA Kit
Sign In for Pricing
View Details 
MBS9912266-04 10x 96 Well
Mouse Glucosamine-6-Phosphate Isomerase 2 (GNPDA2) ELISA Kit
Sign In for Pricing
View Details