IL-1F10/IL-38, Human
IL-1F10/IL-38 Protein is a member of the interleukin 1 cytokine family that regulates adapted and innate immune responses[1]. IL-1F10/IL-38 Protein, Human is the recombinant human-derived IL-1F10/IL-38 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
IL-1F10/IL-38 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-1f10-il-38-protein-human.html
Purity
95.0
Smiles
MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW
Molecular Formula
84639 (Gene_ID) AAI03967.1 (M1-W152) (Accession)
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
F488-30227-01 20 Tests
FineTest®488 Anti-Human CD15/SSEA-1 Antibody (W6D3)
Sign In for Pricing
View Details F488-30227-02 100 Tests
FineTest®488 Anti-Human CD15/SSEA-1 Antibody (W6D3)
Sign In for Pricing
View Details MBS6309417-01 0.1 mL
IFT88, CT (IFT88, TG737, TTC10, Intraflagellar transport protein 88 homolog, Recessive polycystic kidney disease protein Tg737 homolog, Tetratricopeptide repeat protein 10) (MaxLight 650)
Sign In for Pricing
View Details 
MBS6309417-02 5x 0.1 mL
IFT88, CT (IFT88, TG737, TTC10, Intraflagellar transport protein 88 homolog, Recessive polycystic kidney disease protein Tg737 homolog, Tetratricopeptide repeat protein 10) (MaxLight 650)
Sign In for Pricing
View Details