Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1F10/IL-38, Human

IL-1F10/IL-38 Protein is a member of the interleukin 1 cytokine family that regulates adapted and innate immune responses[1]. IL-1F10/IL-38 Protein, Human is the recombinant human-derived IL-1F10/IL-38 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-1F10/IL-38 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1f10-il-38-protein-human.html

Purity

95.0

Smiles

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Molecular Formula

84639 (Gene_ID) AAI03967.1 (M1-W152) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Mre11 Antibody (S03-6H9)
NBP3-15115-100ul 100 µL

Rabbit Monoclonal Mre11 Antibody (S03-6H9)

Sign In for Pricing
View Details
Human desmin, Des ELISA Kit
YLA1752HU-01 48 Tests

Human desmin, Des ELISA Kit

Sign In for Pricing
View Details
Human desmin, Des ELISA Kit
YLA1752HU-02 96 Tests

Human desmin, Des ELISA Kit

Sign In for Pricing
View Details
Uncharacterized protein C7orf50 (C7orf50) Human ELISA Kit
I1127 96 Tests

Uncharacterized protein C7orf50 (C7orf50) Human ELISA Kit

Sign In for Pricing
View Details
Wbp1 ORF Vector (Mouse) (pORF)
50272015 1.0 µg DNA

Wbp1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
CCDC91, CT (CCDC91, GGABP, Coiled-coil domain-containing protein 91, GGA-binding partner, p56 accessory protein) (MaxLight 750) discontinued
033352-ML750 100 µL

CCDC91, CT (CCDC91, GGABP, Coiled-coil domain-containing protein 91, GGA-binding partner, p56 accessory protein) (MaxLight 750) discontinued

Sign In for Pricing
View Details