Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1F10/IL-38, Human

IL-1F10/IL-38 Protein is a member of the interleukin 1 cytokine family that regulates adapted and innate immune responses[1]. IL-1F10/IL-38 Protein, Human is the recombinant human-derived IL-1F10/IL-38 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-1F10/IL-38 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1f10-il-38-protein-human.html

Purity

95.0

Smiles

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Molecular Formula

84639 (Gene_ID) AAI03967.1 (M1-W152) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BFAR, NT (BFAR, BAR, RNF47, Bifunctional apoptosis regulator, RING finger protein 47) (MaxLight 405) discontinued
032502-ML405 100 µL

BFAR, NT (BFAR, BAR, RNF47, Bifunctional apoptosis regulator, RING finger protein 47) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Bovine soluble leptin receptor (sLR) ELISA Kit
NSL0858Bo 96 Tests

Bovine soluble leptin receptor (sLR) ELISA Kit

Sign In for Pricing
View Details
Human Delta-Like Protein 1 (DLL1) CLIA Kit
abx495655-01 96 Tests

Human Delta-Like Protein 1 (DLL1) CLIA Kit

Sign In for Pricing
View Details
Human Delta-Like Protein 1 (DLL1) CLIA Kit
abx495655-02 5x 96 Tests

Human Delta-Like Protein 1 (DLL1) CLIA Kit

Sign In for Pricing
View Details
Human Delta-Like Protein 1 (DLL1) CLIA Kit
abx495655-03 10x 96 Tests

Human Delta-Like Protein 1 (DLL1) CLIA Kit

Sign In for Pricing
View Details
CHMP1A polyclonal antibody
BS71662-01 50 µL

CHMP1A polyclonal antibody

Sign In for Pricing
View Details