Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1F10/IL-38, Human

IL-1F10/IL-38 Protein is a member of the interleukin 1 cytokine family that regulates adapted and innate immune responses[1]. IL-1F10/IL-38 Protein, Human is the recombinant human-derived IL-1F10/IL-38 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-1F10/IL-38 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1f10-il-38-protein-human.html

Purity

95.0

Smiles

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Molecular Formula

84639 (Gene_ID) AAI03967.1 (M1-W152) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Sars Spike Protein Antibody (16F1071R) [Alexa Fluor 750]
NBP2-90998AF750 0.1 mL

Mouse Monoclonal Sars Spike Protein Antibody (16F1071R) [Alexa Fluor 750]

Sign In for Pricing
View Details
BRAF antibody
MBS533489-01 0.1 mL

BRAF antibody

Sign In for Pricing
View Details
BRAF antibody
MBS533489-02 5x 0.1 mL

BRAF antibody

Sign In for Pricing
View Details
EFHD2 Rabbit pAb
MBS8549689-01 0.1 mL

EFHD2 Rabbit pAb

Sign In for Pricing
View Details
EFHD2 Rabbit pAb
MBS8549689-02 0.1 mL (AF405L)

EFHD2 Rabbit pAb

Sign In for Pricing
View Details
EFHD2 Rabbit pAb
MBS8549689-03 0.1 mL (AF405S)

EFHD2 Rabbit pAb

Sign In for Pricing
View Details