Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1F10/IL-38, Human

IL-1F10/IL-38 Protein is a member of the interleukin 1 cytokine family that regulates adapted and innate immune responses[1]. IL-1F10/IL-38 Protein, Human is the recombinant human-derived IL-1F10/IL-38 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-1F10/IL-38 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1f10-il-38-protein-human.html

Purity

95.0

Smiles

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW

Molecular Formula

84639 (Gene_ID) AAI03967.1 (M1-W152) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Genorise® Recombinant Donkey IL-15
GR176012 5 mg

Genorise® Recombinant Donkey IL-15

Sign In for Pricing
View Details
BRG1 Antibody
KC-6076-01 50 μL

BRG1 Antibody

Sign In for Pricing
View Details
BRG1 Antibody
KC-6076-02 100 µL

BRG1 Antibody

Sign In for Pricing
View Details
BRG1 Antibody
KC-6076-03 1 mL

BRG1 Antibody

Sign In for Pricing
View Details
SYCP1 sgRNA CRISPR Lentivector (Human) (Target 2)
K2318903 1.0 µg DNA

SYCP1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Zbtb7b 3'UTR Lenti-reporter-Luc Vector
50722086 1.0 µg

Zbtb7b 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details