IL-1F10/IL-38, Human
IL-1F10/IL-38 Protein is a member of the interleukin 1 cytokine family that regulates adapted and innate immune responses[1]. IL-1F10/IL-38 Protein, Human is the recombinant human-derived IL-1F10/IL-38 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
IL-1F10/IL-38 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-1f10-il-38-protein-human.html
Purity
95.0
Smiles
MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSW
Molecular Formula
84639 (Gene_ID) AAI03967.1 (M1-W152) (Accession)
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680676-100 1x 100 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041012-100 1x 100 µL
S100B (S100B/1012), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details