Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A9, Human (His)

The S100A9 protein is a calcium and zinc binder that plays a critical regulatory role in inflammation and immune responses. Its diverse functions include induction of neutrophil chemotaxis, adhesion, enhanced bactericidal activity through SYK, PI3K/AKT and ERK1/2 activation, and promotion of phagocytosis. S100A9 Protein, Human (His) is the recombinant human-derived S100A9 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A9 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a9-protein-human-his.html

Purity

97.00

Smiles

TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Molecular Formula

6280 (Gene_ID) P06702 (T2-P114) (Accession)

Molecular Weight

Approximately 15-16 kDa as determined by reducing SDS-PAGE; Approximately 30-32 kDa as determined by non-reducing SDS-PAGE.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Thyroid gland
CB506197 1 Block

Frozen Tissue Blocks, Thyroid gland

Sign In for Pricing
View Details
Acid Invertase Microplate Assay Kit
RDSM026 100 Assays

Acid Invertase Microplate Assay Kit

Sign In for Pricing
View Details
D-Galactono-1,4-lactone
TRC-G155400-250MG 250 mg

D-Galactono-1,4-lactone

Sign In for Pricing
View Details
Hieff NGS™ RNA Lib Prep Primer Mix for MGI
13334ES24 24 Tests

Hieff NGS™ RNA Lib Prep Primer Mix for MGI

Sign In for Pricing
View Details
Human CLRN3 activation kit by CRISPRa
GA114688 1 Kit

Human CLRN3 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Myometrium
CR562923 5 µg

Tissue Total RNA, Myometrium

Sign In for Pricing
View Details