Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A9, Human (His)

The S100A9 protein is a calcium and zinc binder that plays a critical regulatory role in inflammation and immune responses. Its diverse functions include induction of neutrophil chemotaxis, adhesion, enhanced bactericidal activity through SYK, PI3K/AKT and ERK1/2 activation, and promotion of phagocytosis. S100A9 Protein, Human (His) is the recombinant human-derived S100A9 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A9 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a9-protein-human-his.html

Purity

97.00

Smiles

TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Molecular Formula

6280 (Gene_ID) P06702 (T2-P114) (Accession)

Molecular Weight

Approximately 15-16 kDa as determined by reducing SDS-PAGE; Approximately 30-32 kDa as determined by non-reducing SDS-PAGE.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Omentum
CB501241 1 Block

Frozen Tissue Blocks, Omentum

Sign In for Pricing
View Details
PTau205 Antibody
KC-29780-01 50 μL

PTau205 Antibody

Sign In for Pricing
View Details
PTau205 Antibody
KC-29780-02 100 µL

PTau205 Antibody

Sign In for Pricing
View Details
PTau205 Antibody
KC-29780-03 1 mL

PTau205 Antibody

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (GM022), CF405S conjugate, 0.1mg/mL
BNC040874-100 1x 100 µL

PLAP (Placental Alkaline Phosphatase) (GM022), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LNP Mouse Monoclonal Antibody [11-1]
EM1701-57 100 µL

LNP Mouse Monoclonal Antibody [11-1]

Sign In for Pricing
View Details