Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A9, Human (His)

The S100A9 protein is a calcium and zinc binder that plays a critical regulatory role in inflammation and immune responses. Its diverse functions include induction of neutrophil chemotaxis, adhesion, enhanced bactericidal activity through SYK, PI3K/AKT and ERK1/2 activation, and promotion of phagocytosis. S100A9 Protein, Human (His) is the recombinant human-derived S100A9 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A9 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a9-protein-human-his.html

Purity

97.00

Smiles

TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Molecular Formula

6280 (Gene_ID) P06702 (T2-P114) (Accession)

Molecular Weight

Approximately 15-16 kDa as determined by reducing SDS-PAGE; Approximately 30-32 kDa as determined by non-reducing SDS-PAGE.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DL-4-Chlorophenylglycine
TRC-C424275-2.5G 2.5 g

DL-4-Chlorophenylglycine

Sign In for Pricing
View Details
Mouse Calcrl activation kit by CRISPRa
GA205729 1 Kit

Mouse Calcrl activation kit by CRISPRa

Sign In for Pricing
View Details
Calcein Deep Red™
21902-AAT 1 mg

Calcein Deep Red™

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR559663 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
DMPO
SIH-324-125MG 125 mg

DMPO

Sign In for Pricing
View Details
CD45 / LCA (2B11), Biotin conjugate, 0.1mg/mL
BNCB0470-500 1x 500 µL

CD45 / LCA (2B11), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details