Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A9, Human (His)

The S100A9 protein is a calcium and zinc binder that plays a critical regulatory role in inflammation and immune responses. Its diverse functions include induction of neutrophil chemotaxis, adhesion, enhanced bactericidal activity through SYK, PI3K/AKT and ERK1/2 activation, and promotion of phagocytosis. S100A9 Protein, Human (His) is the recombinant human-derived S100A9 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A9 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a9-protein-human-his.html

Purity

97.00

Smiles

TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Molecular Formula

6280 (Gene_ID) P06702 (T2-P114) (Accession)

Molecular Weight

Approximately 15-16 kDa as determined by reducing SDS-PAGE; Approximately 30-32 kDa as determined by non-reducing SDS-PAGE.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YY2 (NM_206923) Human Over-expression Lysate
LC404172 20 µg

YY2 (NM_206923) Human Over-expression Lysate

Sign In for Pricing
View Details
3,4-Dihydroxyphenylacetic Acid
TRC-D454250-5G 5 g

3,4-Dihydroxyphenylacetic Acid

Sign In for Pricing
View Details
Frozen Tissue Blocks, Thyroid gland
CB618108 1 Block

Frozen Tissue Blocks, Thyroid gland

Sign In for Pricing
View Details
ZNF740 (NM_001004304) Human Over-expression Lysate
LY424081 100 µg

ZNF740 (NM_001004304) Human Over-expression Lysate

Sign In for Pricing
View Details
Bcas2 Mouse Gene Knockout Kit (CRISPR)
KN502083 1 Kit

Bcas2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Peripheral nerve
CS637049 5x 5 µm

Frozen Tissue Sections, Peripheral nerve

Sign In for Pricing
View Details