Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A9, Human (His)

The S100A9 protein is a calcium and zinc binder that plays a critical regulatory role in inflammation and immune responses. Its diverse functions include induction of neutrophil chemotaxis, adhesion, enhanced bactericidal activity through SYK, PI3K/AKT and ERK1/2 activation, and promotion of phagocytosis. S100A9 Protein, Human (His) is the recombinant human-derived S100A9 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A9 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a9-protein-human-his.html

Purity

97.00

Smiles

TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Molecular Formula

6280 (Gene_ID) P06702 (T2-P114) (Accession)

Molecular Weight

Approximately 15-16 kDa as determined by reducing SDS-PAGE; Approximately 30-32 kDa as determined by non-reducing SDS-PAGE.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cynomolgus Monkey Primary Pulmonary ARoom Temperatureery Smooth Muscle Cells
NHP-PC161 Each

Cynomolgus Monkey Primary Pulmonary ARoom Temperatureery Smooth Muscle Cells

Sign In for Pricing
View Details
Mouse Anti-Duck IgG (H&L) - AcalephFluor790
CSA4257-01 100 µL

Mouse Anti-Duck IgG (H&L) - AcalephFluor790

Sign In for Pricing
View Details
Mouse Anti-Duck IgG (H&L) - AcalephFluor790
CSA4257-02 500 μL

Mouse Anti-Duck IgG (H&L) - AcalephFluor790

Sign In for Pricing
View Details
Mouse Anti-Duck IgG (H&L) - AcalephFluor790
CSA4257-03 1 mL

Mouse Anti-Duck IgG (H&L) - AcalephFluor790

Sign In for Pricing
View Details
Srprb Mouse shRNA Plasmid (Locus ID 20818)
TR502146 1 Kit

Srprb Mouse shRNA Plasmid (Locus ID 20818)

Sign In for Pricing
View Details
Canine Ovalbumin Specific Immunoglobulin G1 ELISA Kit
MBS030839-01 48 Well

Canine Ovalbumin Specific Immunoglobulin G1 ELISA Kit

Sign In for Pricing
View Details