Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17F, Rat (sf9, His)

IL-17F is an inflammatory homodimeric cytokine that induces many proinflammatory cytokines and chemokines. IL-17F also induces antimicrobial peptides. IL-17F plays a protective role in colon cancer development and can be used for the research of autoimmune diseases, infection and cancer[1][2]. IL-17F Protein, Rat (sf9, His) is a recombinant rat IL-17F protein with His tag at the C-terminus and is expressed in sf9 insect cells. It consists of 153 amino acids (M1-A153) .

Product Specifications

Product Name Alternative

IL-17F Protein, Rat (sf9, His), Rat, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17f-protein-rat-sf9-his.html

Purity

97.30

Smiles

ARRNPKVGLSALQKAGNCPPLEDNSVRVDIRIFNQNQGISVPRDFQNRSSSPWDYNITRDPDRFPSEIAEAQCRHSGCINAQGQEDGSMNSVPIQQEILVLRREPQGCSNSFRLEKMLIKVGCTCVTPIVHHAA

Molecular Formula

301291 (Gene_ID) Q5BJ95 (A28-A161) (Accession)

Molecular Weight

Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Chang SH, et al. IL-17F: regulation, signaling and function in inflammation. Cytokine. 2009 Apr;46 (1) :7-11.|[2]McGeachy MJ, et al. The IL-17 Family of Cytokines in Health and Disease. Immunity. 2019 Apr 16;50 (4) :892-906.|[3]Ferreira N, et al. IL-17A and IL-17F orchestrate macrophages to promote lung cancer. Cell Oncol (Dordr) . 2020 Aug;43 (4) :643-654.|[4]Tong Z, et al. A protective role by interleukin-17F in colon tumorigenesis. PLoS One. 2012;7 (4) :e34959.|[5]Gao X, et al. [Effects of IL-17F/IL-17RC on the expression of caveolae-1 in rat pulmonary microvascular endothelial cells]. Zhonghua Yi Xue Za Zhi. 2015 Mar 31;95 (12) :938-42.|[6]Zhang N, et al. IL-17F promotes osteoblastic osteogenesis via the MAPK/ERK1/2 signaling pathway. Exp Ther Med. 2021 Oct;22 (4) :1052.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

H4C11 (NM_021968) Human Over-expression Lysate
LC411853 20 µg

H4C11 (NM_021968) Human Over-expression Lysate

Ask
View Details
hsa-miR-4320 miRNA Agomir
MBS8311727-01 5 nmol

hsa-miR-4320 miRNA Agomir

Ask
View Details
hsa-miR-4320 miRNA Agomir
MBS8311727-02 10 nmol

hsa-miR-4320 miRNA Agomir

Ask
View Details
hsa-miR-4320 miRNA Agomir
MBS8311727-03 20 nmol

hsa-miR-4320 miRNA Agomir

Ask
View Details
hsa-miR-4320 miRNA Agomir
MBS8311727-04 5x 20 nmol

hsa-miR-4320 miRNA Agomir

Ask
View Details
CD4a antibody (Spectral Red)
MBS5318171-01 0.1 mg

CD4a antibody (Spectral Red)

Ask
View Details