Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cow Alpha Actinin 3 (ACTN3) ELISA Kit

Product Specifications

Applications

ELISA

Notes

This product is for research use only. The range and sensitivity is subject to change. Please contact us for the latest product information. For accurate results, sample concentrations must be diluted to mid-range of the kit. If you require a specific range, please contact us in advance or write your request in your order comments. Please note that our ELISA and CLIA kits are optimised for detection of native samples, rather than recombinant proteins. We are unable to guarantee detection of recombinant proteins, as they may have different sequences or tertiary structures to the native protein.

Tested Applications

ELISA

More Discoveries

Explore Other Products

Browse additional items from our catalog

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
MBS5818163 Inquire

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
ADA23 rabbit pAb
ES9352-01 50 µL

ADA23 rabbit pAb

Sign In for Pricing
View Details
ADA23 rabbit pAb
ES9352-02 100 µL

ADA23 rabbit pAb

Sign In for Pricing
View Details
Recombinant Vanderwaltozyma polyspora Autophagy-related protein 9 (ATG9), partial
MBS1146614-01 1 mg (E-Coli)

Recombinant Vanderwaltozyma polyspora Autophagy-related protein 9 (ATG9), partial

Sign In for Pricing
View Details
Recombinant Vanderwaltozyma polyspora Autophagy-related protein 9 (ATG9), partial
MBS1146614-02 1 mg (Yeast)

Recombinant Vanderwaltozyma polyspora Autophagy-related protein 9 (ATG9), partial

Sign In for Pricing
View Details
Human ALF (GTF2A1L) (NM_006872) AAV Particle
RC205264A1V 250 µL

Human ALF (GTF2A1L) (NM_006872) AAV Particle

Sign In for Pricing
View Details