Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ILDR2, Human (HEK293, His)

ILDR2 proteins play multiple roles in cellular processes, participating in ER stress pathways, affecting lipid homeostasis, and affecting insulin secretion. It is involved in maintaining epithelial barrier function and recruiting MARVELD2/trifibrin into tight junctions, emphasizing its role in cellular integrity. ILDR2 Protein, Human (HEK293, His) is the recombinant human-derived ILDR2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ILDR2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ildr2-protein-human-hek-293-his.html

Purity

98.0

Smiles

LQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPE

Molecular Formula

387597 (Gene_ID) Q71H61 (L21-E186) (Accession)

Molecular Weight

45-55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C6orf64 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-9529R-BF405 100 µL

C6orf64 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
IAA17 Antibody
orb840590 2 mg

IAA17 Antibody

Sign In for Pricing
View Details
Mouse Iduronate 2 sulfatase ELISA Kit
orb385383 96 Tests

Mouse Iduronate 2 sulfatase ELISA Kit

Sign In for Pricing
View Details
SDR Antibody (Biotin)
orb518123-01 50 μL

SDR Antibody (Biotin)

Sign In for Pricing
View Details
SDR Antibody (Biotin)
orb518123-02 100 µL

SDR Antibody (Biotin)

Sign In for Pricing
View Details
CABC1 (ADCK3, CABC1, Chaperone activity of bc1 complex-like, mitochondrial, aarF domain-containing protein kinase 3) (Azide free) (HRP)
MBS6121467-01 0.2 mL

CABC1 (ADCK3, CABC1, Chaperone activity of bc1 complex-like, mitochondrial, aarF domain-containing protein kinase 3) (Azide free) (HRP)

Sign In for Pricing
View Details