Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLIC1, Human (N-His)

The CLIC1 protein exhibits specific lysophospholipase activity and plays a critical role in mediating cellular responses to oxidative stress. As a member of the chloride intracellular channel family, CLIC1 is involved in a variety of physiological processes, including cell volume regulation, membrane potential regulation, and regulation of cell cycle progression. CLIC1 Protein, Human (N-His) is the recombinant human-derived CLIC1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CLIC1 Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clic1-protein-human-n-his.html

Purity

94.20

Smiles

AEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK

Molecular Formula

1192 (Gene_ID) O00299 (A2-K241) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL
BNC470861-500 1x 500 µL

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
BNC040029-500 1x 500 µL

Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL
BNC400391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (NCAM1/2217R), CF488A conjugate, 0.1mg/mL
BNC882217-100 1x 100 µL

CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (NCAM1/2217R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIMP1 (Marker of Lymph Node Metastasis) (2A5), CF740 conjugate, 0.1mg/mL
BNC741648-100 1x 100 µL

TIMP1 (Marker of Lymph Node Metastasis) (2A5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD147 (8D6), CF594 conjugate, 0.1mg/mL
BNC940424-500 1x 500 µL

CD147 (8D6), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details