Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLIC1, Human (N-His)

The CLIC1 protein exhibits specific lysophospholipase activity and plays a critical role in mediating cellular responses to oxidative stress. As a member of the chloride intracellular channel family, CLIC1 is involved in a variety of physiological processes, including cell volume regulation, membrane potential regulation, and regulation of cell cycle progression. CLIC1 Protein, Human (N-His) is the recombinant human-derived CLIC1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CLIC1 Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clic1-protein-human-n-his.html

Purity

94.20

Smiles

AEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK

Molecular Formula

1192 (Gene_ID) O00299 (A2-K241) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAA antibody
10R-10304 100 ug

FAA antibody

Sign In for Pricing
View Details
NR2F6 (NM_005234) Human Recombinant Protein
TP301336M 100 µg

NR2F6 (NM_005234) Human Recombinant Protein

Sign In for Pricing
View Details
SUOX Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV690104 1.0 µg DNA

SUOX Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Cicer arietinum Lectin (CAL/CPA) - Separopore® 4B MicroPass™
21511052-1 Inquire

Cicer arietinum Lectin (CAL/CPA) - Separopore® 4B MicroPass™

Sign In for Pricing
View Details
TFDP3 Rabbit Polyclonal Antibody
TA330180 100 µL

TFDP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Granzyme B (C11, CTLA-1, Cathepsin G-like 1, CTSGL1, Cytotoxic T-lymphocyte Proteinase 2, Lymphocyte Protease, Fragmentin-2, Granzyme-2, Human Lymphocyte Protein, HLP, SECT, T-cell Serine Protease 1-3E, GZMB, CGL1, CSPB, CTLA1, GRB) (MaxLight 750)
MBS6233110-01 0.1 mL

Granzyme B (C11, CTLA-1, Cathepsin G-like 1, CTSGL1, Cytotoxic T-lymphocyte Proteinase 2, Lymphocyte Protease, Fragmentin-2, Granzyme-2, Human Lymphocyte Protein, HLP, SECT, T-cell Serine Protease 1-3E, GZMB, CGL1, CSPB, CTLA1, GRB) (MaxLight 750)

Sign In for Pricing
View Details