Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Human (N-His)

IL-1 beta protein is a potent proinflammatory cytokine that plays multiple roles in immune responses. It induces inflammatory events including prostaglandin synthesis, neutrophil activation, and cytokine production. IL-1 beta Protein, Human (N-His) is the recombinant human-derived IL-1beta protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1beta-protein-human-153aa-his.html

Purity

96.90

Smiles

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Molecular Formula

3553 (Gene_ID) P01584 (A117-S269) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EPOR Recombinant Protein
PPT-12536 100 µg

Human EPOR Recombinant Protein

Sign In for Pricing
View Details
Anti-BIK (pS35) Phospho Antibody
MBS8304211-01 0.03 mL

Anti-BIK (pS35) Phospho Antibody

Sign In for Pricing
View Details
Anti-BIK (pS35) Phospho Antibody
MBS8304211-02 0.05 mL

Anti-BIK (pS35) Phospho Antibody

Sign In for Pricing
View Details
Anti-BIK (pS35) Phospho Antibody
MBS8304211-03 0.1 mL

Anti-BIK (pS35) Phospho Antibody

Sign In for Pricing
View Details
Anti-BIK (pS35) Phospho Antibody
MBS8304211-04 0.2 mL

Anti-BIK (pS35) Phospho Antibody

Sign In for Pricing
View Details
Anti-BIK (pS35) Phospho Antibody
MBS8304211-05 5x 0.2 mL

Anti-BIK (pS35) Phospho Antibody

Sign In for Pricing
View Details