Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDNF, Mouse (CHO)

Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. GDNF Protein, Mouse (CHO) is produced in CHO cells, and consists of 134 amino acids (S78-I211) .

Product Specifications

Product Name Alternative

GDNF Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdnf-protein-mouse-cho.html

Purity

95.00

Smiles

MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Molecular Formula

14573 (Gene_ID) P48540 (S78-I211) (Accession)

Molecular Weight

Approximately 17-22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Merighi A. Targeting the glial-derived neurotrophic factor and related molecules for controlling normal and pathologic pain. Expert Opin Ther Targets. 2016;20 (2) :193-208.|[2]Alberto F Cintrón-Colón, et al. GDNF synthesis, signaling, and retrograde transport in motor neurons. Cell Tissue Res. 2020 Oct;382 (1) :47-56.|[3]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.|[4]Hannu Sariola, et al. GDNF maintains mouse spermatogonial stem cells in vivo and in vitro. Methods Mol Biol. 2008;450:127-35.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adam29 Mouse Gene Knockout Kit (CRISPR)
KN500833 1 Kit

Adam29 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/3286), CF640R conjugate, 0.1mg/mL
BNC403286-100 1x 100 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/3286), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Protein C (PROC) (NM_000312) Human Recombinant Protein
TP306582 20 µg

Protein C (PROC) (NM_000312) Human Recombinant Protein

Sign In for Pricing
View Details
Ethyl (2-Azidoethoxy-d4)acetoacetate
TRC-E899557-25MG 25 mg

Ethyl (2-Azidoethoxy-d4)acetoacetate

Sign In for Pricing
View Details
Gpx1 Goat Polyclonal Antibody
AP32027PU-N 100 µg

Gpx1 Goat Polyclonal Antibody

Sign In for Pricing
View Details
Galectin 10 (CLC) (NM_001828) Human Over-expression Lysate
LC419729 20 µg

Galectin 10 (CLC) (NM_001828) Human Over-expression Lysate

Sign In for Pricing
View Details