Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDNF, Mouse (CHO)

Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs) ., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. GDNF Protein, Mouse (CHO) is produced in CHO cells, and consists of 134 amino acids (S78-I211) .

Product Specifications

Product Name Alternative

GDNF Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gdnf-protein-mouse-cho.html

Purity

95.00

Smiles

MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Molecular Formula

14573 (Gene_ID) P48540 (S78-I211) (Accession)

Molecular Weight

Approximately 17-22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Merighi A. Targeting the glial-derived neurotrophic factor and related molecules for controlling normal and pathologic pain. Expert Opin Ther Targets. 2016;20 (2) :193-208.|[2]Alberto F Cintrón-Colón, et al. GDNF synthesis, signaling, and retrograde transport in motor neurons. Cell Tissue Res. 2020 Oct;382 (1) :47-56.|[3]Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature.1995;373 (6512) : 335-339.|[4]Hannu Sariola, et al. GDNF maintains mouse spermatogonial stem cells in vivo and in vitro. Methods Mol Biol. 2008;450:127-35.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDHGB2 (NM_032096) Human Recombinant Protein
PH37002M5 20 µg

PCDHGB2 (NM_032096) Human Recombinant Protein

Sign In for Pricing
View Details
Purified anti-human CD52
FC1501 1 mg

Purified anti-human CD52

Sign In for Pricing
View Details
Caspase-8 Rabbit mAb
58547 50 µL

Caspase-8 Rabbit mAb

Sign In for Pricing
View Details
FAM98C Rabbit Polyclonal Antibody (BF488)
orb2503957 100 µL

FAM98C Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
ACE Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-0439R-BF555-TR 20 µL

ACE Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Recombinant Mouse IL-2RB /CD122 (C-His)
32-9149-500 500 µg

Recombinant Mouse IL-2RB /CD122 (C-His)

Sign In for Pricing
View Details