Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 epsilon, Mouse (His)

14-3-3 epsilon proteins are adapter proteins in various signaling pathways that bind to phosphoserine or phosphothreonine motifs to regulate chaperone activity.It positively regulates HSF1 nuclear export to the cytoplasm, forming homo- and heterodimers with YWHAZ.14-3-3 epsilon Protein, Mouse (His) is the recombinant mouse-derived 14-3-3 epsilon protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

14-3-3 epsilon Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-epsilon-protein-mouse-gst.html

Purity

98.0

Smiles

MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ

Molecular Formula

22627 (Gene_ID) P62259 (M1-Q255) (Accession)

Molecular Weight

Approximately 31 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant C10orf63 Antibody
RC-15346-01 50 μL

Recombinant C10orf63 Antibody

Sign In for Pricing
View Details
Recombinant C10orf63 Antibody
RC-15346-02 100 µL

Recombinant C10orf63 Antibody

Sign In for Pricing
View Details
Recombinant C10orf63 Antibody
RC-15346-03 1 mL

Recombinant C10orf63 Antibody

Sign In for Pricing
View Details
SOX2 (Transcription Factor) (SOX2/1792), CF640R conjugate, 0.1mg/mL
BNC401792-500 1x 500 µL

SOX2 (Transcription Factor) (SOX2/1792), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CPA4 (NM_001163446) Human Over-expression Lysate
LY431341 100 µg

CPA4 (NM_001163446) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS802053 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details