Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 epsilon, Mouse (His)

14-3-3 epsilon proteins are adapter proteins in various signaling pathways that bind to phosphoserine or phosphothreonine motifs to regulate chaperone activity.It positively regulates HSF1 nuclear export to the cytoplasm, forming homo- and heterodimers with YWHAZ.14-3-3 epsilon Protein, Mouse (His) is the recombinant mouse-derived 14-3-3 epsilon protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

14-3-3 epsilon Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/14-3-3-epsilon-protein-mouse-gst.html

Purity

98.0

Smiles

MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ

Molecular Formula

22627 (Gene_ID) P62259 (M1-Q255) (Accession)

Molecular Weight

Approximately 31 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein A FITC Colloidal Gold, 1mL 20nm
FGP-01-20 1 mL

Protein A FITC Colloidal Gold, 1mL 20nm

Sign In for Pricing
View Details
E Cadherin (CDH1) Mouse Monoclonal Antibody [Clone ID: 5H9]
AM32138PU-N 100 µg

E Cadherin (CDH1) Mouse Monoclonal Antibody [Clone ID: 5H9]

Sign In for Pricing
View Details
FITC Anti-Mouse TER-119 Antibody[TER-119]
E-AB-F1125UC-01 25 µg

FITC Anti-Mouse TER-119 Antibody[TER-119]

Sign In for Pricing
View Details
FITC Anti-Mouse TER-119 Antibody[TER-119]
E-AB-F1125UC-02 100 µg

FITC Anti-Mouse TER-119 Antibody[TER-119]

Sign In for Pricing
View Details
FCHSD2 (NM_014824) Human Recombinant Protein
TP321241 20 µg

FCHSD2 (NM_014824) Human Recombinant Protein

Sign In for Pricing
View Details
PATJ Human qPCR Primer Pair (NM_176877)
HP234069 200 Reactions

PATJ Human qPCR Primer Pair (NM_176877)

Sign In for Pricing
View Details