Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BD-3, Human

BD-3 Protein, Human is an antibacterial peptide that exhibits antibacterial activities towards Gram-negative and Gram-positive bacteria as well as an ability to act as a chemo-attractant.

Product Specifications

Product Name Alternative

BD-3 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bd-3-protein-human.html

Purity

98.0

Smiles

GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK

Molecular Formula

55894 (Gene_ID) P81534 (G23-K67) (Accession)

Molecular Weight

Approximately 5.2 kDa

References & Citations

[1]Dhople V, et al. The human beta-defensin-3, an antibacterial peptide with multiple biological functions. Biochim Biophys Acta. 2006 Sep;1758 (9) :1499-512.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL6P15 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
41759111 3x 1.0 µg

RPL6P15 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
EPHA10 Rabbit Polyclonal Antibody
orb515319-01 30 µL

EPHA10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EPHA10 Rabbit Polyclonal Antibody
orb515319-02 50 μL

EPHA10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EPHA10 Rabbit Polyclonal Antibody
orb515319-03 100 µL

EPHA10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EPHA10 Rabbit Polyclonal Antibody
orb515319-04 200 µL

EPHA10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Succinyl-diaminopimelate desuccinylase (dapE)
MBS1091156-01 0.02 mg (E-Coli)

Recombinant Acinetobacter baumannii Succinyl-diaminopimelate desuccinylase (dapE)

Sign In for Pricing
View Details