Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BD-3, Human

BD-3 Protein, Human is an antibacterial peptide that exhibits antibacterial activities towards Gram-negative and Gram-positive bacteria as well as an ability to act as a chemo-attractant.

Product Specifications

Product Name Alternative

BD-3 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bd-3-protein-human.html

Purity

98.0

Smiles

GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK

Molecular Formula

55894 (Gene_ID) P81534 (G23-K67) (Accession)

Molecular Weight

Approximately 5.2 kDa

References & Citations

[1]Dhople V, et al. The human beta-defensin-3, an antibacterial peptide with multiple biological functions. Biochim Biophys Acta. 2006 Sep;1758 (9) :1499-512.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CEACAM5/CD66e Antibody (COL-1 + CEA31 + C66/261) - IHC-Prediluted
NBP2-44905 7 mL

Mouse Monoclonal CEACAM5/CD66e Antibody (COL-1 + CEA31 + C66/261) - IHC-Prediluted

Sign In for Pricing
View Details
SPARC Protein Lysate
OCOA13778-20UG 20 µg

SPARC Protein Lysate

Sign In for Pricing
View Details
1- (4-Nitrophenyl) propane-1,2,3-triol
OR22490-01 1 g

1- (4-Nitrophenyl) propane-1,2,3-triol

Sign In for Pricing
View Details
1- (4-Nitrophenyl) propane-1,2,3-triol
OR22490-02 5 g

1- (4-Nitrophenyl) propane-1,2,3-triol

Sign In for Pricing
View Details
CD300 antigen (CD300A) (NM_007261) Human Over-expression Lysate
E45H08584-2 20 µg

CD300 antigen (CD300A) (NM_007261) Human Over-expression Lysate

Sign In for Pricing
View Details
mmu-miR-543 miRNA Inhibitor
MIM02271 2x 5.0 nmol

mmu-miR-543 miRNA Inhibitor

Sign In for Pricing
View Details