Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galectin-3/LGALS3, Human

Galectin-3/LGALS3 Protein is a type of galactoside-binding lectin that has a high binding affinity for carbohydrates with β-galactoside linkages. Galectin-3/LGALS3 Protein interacts with glycosylated proteins to mediate intercellular interactions and adhesion to the extracellular matrix. Galectin-3/LGALS3 Protein plays various roles, including regulating signaling pathways such as Wnt/β-catenin, affecting cell proliferation and survival, modulating immune functions, and influencing tumor progression. Galectin-3/LGALS3 Protein, Human is a recombinant galectin-3/LGALS3 protein expressed in E. coli[1][2].

Product Specifications

Product Name Alternative

Galectin-3/LGALS3 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/galectin-3-lgals3-protein-human.html

Purity

98.00

Smiles

ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

Molecular Formula

3958 (Gene_ID) P17931 (A2-I250) (Accession)

Molecular Weight

Approximately 29 kDa

References & Citations

[1]Chaudoin TR, et al. Mice lacking galectin-3 (Lgals3) function have decreased home cage movement. BMC Neurosci. 2018 May 2;19 (1) :27. |[2]Demetriou M, et al. Negative regulation of T-cell activation and autoimmunity by Mgat5 N-glycosylation. Nature. 2001 Feb 8;409 (6821) :733-9. |[3]Chalise U, et al. Macrophages secrete murinoglobulin-1 and galectin-3 to regulate neutrophil degranulation after myocardial infarction. Mol Omics. 2022 Mar 28;18 (3) :186-195. |[4]Yoshimura A, et al. Increased expression of the LGALS3 (galectin 3) gene in human non-small-cell lung cancer. Genes Chromosomes Cancer. 2003 Jun;37 (2) :159-64. |[5]Kulow VA, et al. Galectin-3 protects distal convoluted tubules in rhabdomyolysis-induced kidney injury. Pflugers Arch. 2024 Jul 23. |[6]Braeuer RR, et al. Galectin-3 contributes to melanoma growth and metastasis via regulation of NFAT1 and autotaxin. Cancer Res. 2012 Nov 15;72 (22) :5757-66.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZSCAN2 Antibody
GWB-9ABDED 0.05 mg

ZSCAN2 Antibody

Ask
View Details
Lysozyme (LYZ, LZM, 1,4-beta-N-acetylmuramidase C, Lysozyme C) (MaxLight 550)
MBS6255094-01 0.1 mL

Lysozyme (LYZ, LZM, 1,4-beta-N-acetylmuramidase C, Lysozyme C) (MaxLight 550)

Ask
View Details
Lysozyme (LYZ, LZM, 1,4-beta-N-acetylmuramidase C, Lysozyme C) (MaxLight 550)
MBS6255094-02 5x 0.1 mL

Lysozyme (LYZ, LZM, 1,4-beta-N-acetylmuramidase C, Lysozyme C) (MaxLight 550)

Ask
View Details
HINT2 Human Recombinant Protein
TP726426 50 µg

HINT2 Human Recombinant Protein

Ask
View Details
Opioid Receptor, Kappa (Biotin) discontinued
171706-Biotin 100 µL

Opioid Receptor, Kappa (Biotin) discontinued

Ask
View Details