Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATTO488-ProTx-II

ATTO488-ProTx-II is a fluorescently labeled ProTx-II, a famous Nav1.7 blocker. The wild type ProTx-II blocks Nav1.7 with an IC50 value of around 300 pM, Nav1.2, Nav1.5 and Nav1.6 with IC50 values of 41 nM, 79 nM and 26 nM respectively.ATTO488-ProTx-II has been tested and its biological activity has been validated.

Product Specifications

Specifications

Nav1.7 selective blocker

Target

Na channels

Sequence

YCQKWMWTCDSERKCCEGMVCRLWCKKKLW

Peptide Number

PTF004

Disulfide Bonds

Cys2-Cys16; Cys9-Cys21; Cys15-Cys25

N Terminal Sequence

ATTO488

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5'-Deoxy-5'-N-(2-chloroethyl)aminothymidine

MBS5826996 Inquire

5'-Deoxy-5'-N-(2-chloroethyl)aminothymidine

Sign In for Pricing

ULK2 Protein Vector (Mouse) (pPB-C-His)

PV244114 500 ng

ULK2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing

TAS2R49 Rabbit Polyclonal Antibody (BF647)

orb2540898 100 µL

TAS2R49 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing

Lentiviral human UBE2N shRNA (UAS) - Lentiviral human UBE2N shRNA (UAS, RFP) (25)

GTR15104111 1 Vial

Lentiviral human UBE2N shRNA (UAS) - Lentiviral human UBE2N shRNA (UAS, RFP) (25)

Sign In for Pricing

Gamma Synuclein/SNCG Recombinant Rabbit mAb

E43S48856 100 µL

Gamma Synuclein/SNCG Recombinant Rabbit mAb

Sign In for Pricing

VEGFR2 Polyclonal Antibody Bio Conjugated

C90236Bio 100 µL

VEGFR2 Polyclonal Antibody Bio Conjugated

Sign In for Pricing