ATTO488-ProTx-II
ATTO488-ProTx-II is a fluorescently labeled ProTx-II, a famous Nav1.7 blocker. The wild type ProTx-II blocks Nav1.7 with an IC50 value of around 300 pM, Nav1.2, Nav1.5 and Nav1.6 with IC50 values of 41 nM, 79 nM and 26 nM respectively.ATTO488-ProTx-II has been tested and its biological activity has been validated.
Product Specifications
Specifications
Nav1.7 selective blocker
Target
Na channels
Sequence
YCQKWMWTCDSERKCCEGMVCRLWCKKKLW
Peptide Number
PTF004
Disulfide Bonds
Cys2-Cys16; Cys9-Cys21; Cys15-Cys25
N Terminal Sequence
ATTO488
C Terminal Sequence
OH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
116100A0-AAT 100 Tests
IFluor® 560 Anti-human CD161 Antibody *HP-3G10*
Sign In for Pricing
View Details 
LV654047 1.0 µg DNA
LYVE1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
Sign In for Pricing
View Details MBS1087062-01 0.02 mg (E-Coli)
Recombinant Synechocystis sp. Photosystem II 12 kDa extrinsic protein (psbU)
Sign In for Pricing
View Details MBS1087062-02 0.1 mg (E-Coli)
Recombinant Synechocystis sp. Photosystem II 12 kDa extrinsic protein (psbU)
Sign In for Pricing
View Details MBS1087062-03 0.02 mg (Yeast)
Recombinant Synechocystis sp. Photosystem II 12 kDa extrinsic protein (psbU)
Sign In for Pricing
View Details