Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATTO488-ProTx-I

ATTO488-ProTx-I (Protoxin 1; β-theraphotoxin-Tp1a) is a fluorescently labeled ProTx-I that was originally isolated from the venom of Thrixopelma pruriens (Peruvian green velvet tarantula) . This toxin reversibly inhibits the tetrodotoxin (TTX) -resistant channel Nav1.8 (IC50 = 27 nM) and Nav1.2, Nav1.5 and Nav1.7 with IC50 values between 50 and 100 nM. Furthermore, ProTx-I shifts the voltage dependence activity of T-type Cav3.1 channels (IC50= 50 nM) without affecting the voltage dependence of inactivation. ProTx-I is a valuable tool to discriminate between Cav3.1 and Cav3.2. ProTx-I is also an antagonist of TRAP1.

Product Specifications

Specifications

Blocker of voltage-gated sodium channels and T-type Cav

Target

Na channels

Sequence

ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS

Peptide Number

PTF003

Disulfide Bonds

Cys2-Cys16; Cys9-Cys21; Cys15-Cys25

N Terminal Sequence

ATTO488

C Terminal Sequence

OH

More Discoveries

Explore Other Products

Browse additional items from our catalog

DB123 rabbit pAb
E28PN3659 100 µL

DB123 rabbit pAb

Sign In for Pricing
View Details
SNORA44 AAV siRNA Pooled Vector
44613161 1.0 µg

SNORA44 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Sheep Glycophorin A ELISA Kit
MBS054501-01 48 Well

Sheep Glycophorin A ELISA Kit

Sign In for Pricing
View Details
Sheep Glycophorin A ELISA Kit
MBS054501-02 96 Well

Sheep Glycophorin A ELISA Kit

Sign In for Pricing
View Details
Sheep Glycophorin A ELISA Kit
MBS054501-03 5x 96 Well

Sheep Glycophorin A ELISA Kit

Sign In for Pricing
View Details
Sheep Glycophorin A ELISA Kit
MBS054501-04 10x 96 Well

Sheep Glycophorin A ELISA Kit

Sign In for Pricing
View Details