Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATTO488-ProTx-I

ATTO488-ProTx-I (Protoxin 1; β-theraphotoxin-Tp1a) is a fluorescently labeled ProTx-I that was originally isolated from the venom of Thrixopelma pruriens (Peruvian green velvet tarantula) . This toxin reversibly inhibits the tetrodotoxin (TTX) -resistant channel Nav1.8 (IC50 = 27 nM) and Nav1.2, Nav1.5 and Nav1.7 with IC50 values between 50 and 100 nM. Furthermore, ProTx-I shifts the voltage dependence activity of T-type Cav3.1 channels (IC50= 50 nM) without affecting the voltage dependence of inactivation. ProTx-I is a valuable tool to discriminate between Cav3.1 and Cav3.2. ProTx-I is also an antagonist of TRAP1.

Product Specifications

Specifications

Blocker of voltage-gated sodium channels and T-type Cav

Target

Na channels

Sequence

ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS

Peptide Number

PTF003

Disulfide Bonds

Cys2-Cys16; Cys9-Cys21; Cys15-Cys25

N Terminal Sequence

ATTO488

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B7-1 (CD80) Mouse Monoclonal Antibody [Clone 7E4]
E45M10230V-2 50 µL

B7-1 (CD80) Mouse Monoclonal Antibody [Clone 7E4]

Sign In for Pricing
View Details
MTHFSD Antibody - N-terminal region
ARP40988_P050-25UL 25 µL

MTHFSD Antibody - N-terminal region

Sign In for Pricing
View Details
CRYL1 CRISPR Knock Out 293T Cell Line (Human)
16894141 1x 10^6 Cells / 1.0 mL

CRYL1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Oit3 (NM_001001507) Rat Tagged Lenti ORF Clone
RR211781L3 10 µg

Oit3 (NM_001001507) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Chamaecyparis obtusa Pectate lyase 1
MBS9422808-01 0.02 mg

Recombinant Chamaecyparis obtusa Pectate lyase 1

Sign In for Pricing
View Details
Recombinant Chamaecyparis obtusa Pectate lyase 1
MBS9422808-02 0.1 mg

Recombinant Chamaecyparis obtusa Pectate lyase 1

Sign In for Pricing
View Details