Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Phrixotoxin-2

Phrixotoxin-2 (PaTx2) has been isolated originally from the venom of the Chile fire tarantula Phrixotrichus auratus. Phrixotoxin-2 is a 31 amino acid peptide that contains three disulfide bridges. Phrixotoxin-2 specifically blocks recombinant Kv4.2 and Kv4.3 currents with IC50 values of 34 nM and 71 nM, respectively. It does so by altering the gating properties of the channels. The inhibition of Kv4.2 and Kv4.3 currents is fully reversible upon washout. Kv4.1 is only slightly sensitive to Phrixotoxin-2 (maximal block of 20 by 300 nM) . Kv1, Kv2 and Kv3 channel subfamilies are insensitive to this toxin.

Product Specifications

CAS Number

221889-63-0

Specifications

Blocker of Kv4.2 and Kv4.3 channels

Target

K channels

Sequence

YCQKWMWTCDEERKCCEGLVCRLWCKRIINM

Peptide Number

PHX002

Disulfide Bonds

Cys2-Cys16; Cys9-Cys21; Cys15-Cys25

N Terminal Sequence

H

C Terminal Sequence

NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C5orf49-set siRNA/shRNA/RNAi Lentivector (Human)
14586091 4x 500 ng

C5orf49-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Apolipoprotein H (APOH) Recombinant, Human
153586-01 10 µg

Apolipoprotein H (APOH) Recombinant, Human

Sign In for Pricing
View Details
Apolipoprotein H (APOH) Recombinant, Human
153586-02 50 µg

Apolipoprotein H (APOH) Recombinant, Human

Sign In for Pricing
View Details
Apolipoprotein H (APOH) Recombinant, Human
153586-03 200 µg

Apolipoprotein H (APOH) Recombinant, Human

Sign In for Pricing
View Details
PLAGL2 Rabbit Polyclonal Antibody (APC)
orb2702070 100 µg

PLAGL2 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
GM CSF (CSF2) Human Gene Knockout Kit (CRISPR)
KN411109 1 Kit

GM CSF (CSF2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details