Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Phlotoxin-1

Phlotoxin-1 is a new member of the NaSpTx-1 family. Phlotoxin-1 has been purified originally from the venom of Phlogiellus sp., Theraphosidae Selenocosmiinae (endemic to Papua New Guinea) . Phlotoxin-1 inhibits Nav1.7 with an IC50 value of 39 ± 2 nM.

Product Specifications

Specifications

Blocker of Nav1.7 channel

Target

Na channels

Sequence

ACLGQWDSCDPKASKCCPNYACEWKYPWCRYKLF

Peptide Number

PHX001

Disulfide Bonds

Cys1-Cys4; Cys2-Cys5; Cys3-Cys6

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Arf3 shRNA (UAS) - Lentiviral mouse Arf3 shRNA (UAS, GFP) (100)
GTR15178233 1 Vial

Lentiviral mouse Arf3 shRNA (UAS) - Lentiviral mouse Arf3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Nebulette (NEBL) Antibody
abx430168 200 µL

Nebulette (NEBL) Antibody

Sign In for Pricing
View Details
PRDX4 Antibody
OAGA05409-100UL 100 µL

PRDX4 Antibody

Sign In for Pricing
View Details
Mecom 3'UTR Lenti-reporter-Luc Vector
28284086 1.0 µg

Mecom 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Recombinant Clostridium Acetobutylicum hisH Protein (aa 1-203)
VAng-Lsx7635-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Acetobutylicum hisH Protein (aa 1-203)

Sign In for Pricing
View Details
Recombinant Mouse Sphingolipid delta (4)-desaturase DES1 (Degs1), partial
MBS7054637 Inquire

Recombinant Mouse Sphingolipid delta (4)-desaturase DES1 (Degs1), partial

Sign In for Pricing
View Details