Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Iberiotoxin

Iberiotoxin (IbTx) is a toxin that was originally isolated from Buthus tamulus scorpion venom. Iberiotoxin inhibits selectively the high conductance Ca2+-activated K+ channel (KCa1.1) at nanomolar concentrations (IC50 ~2 nM) . This toxin does not affect other types of calcium-dependent or voltage-dependent K+ channels. Iberiotoxin is a valuable tool to study specifically Maxi-K channels.

Product Specifications

CAS Number

129203-60-7

Specifications

Blocker of high conductance Ca2+-activated K+ channel

Target

K channels

Sequence

FTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ

Peptide Number

12IBX001

Disulfide Bonds

Cys7-Cys28; Cys13-Cys33; Cys17-Cys35

N Terminal Sequence

PQ

C Terminal Sequence

OH

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mesothelin, Cynomolgus (HEK293, His)
HY-P77796 Inquire

Mesothelin, Cynomolgus (HEK293, His)

Sign In for Pricing
View Details
TDRD9 Antibody; FITC conjugated
MBS7004551-01 0.05 mg

TDRD9 Antibody; FITC conjugated

Sign In for Pricing
View Details
TDRD9 Antibody; FITC conjugated
MBS7004551-02 0.1 mg

TDRD9 Antibody; FITC conjugated

Sign In for Pricing
View Details
TDRD9 Antibody; FITC conjugated
MBS7004551-03 5x 0.1 mg

TDRD9 Antibody; FITC conjugated

Sign In for Pricing
View Details
Sodium ionophore III 25mg
A20813-25 25 mg

Sodium ionophore III 25mg

Sign In for Pricing
View Details
PCNA Monoclonal Antibody
MBS2579015-01 0.025 mL

PCNA Monoclonal Antibody

Sign In for Pricing
View Details