Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Iberiotoxin

Iberiotoxin (IbTx) is a toxin that was originally isolated from Buthus tamulus scorpion venom. Iberiotoxin inhibits selectively the high conductance Ca2+-activated K+ channel (KCa1.1) at nanomolar concentrations (IC50 ~2 nM) . This toxin does not affect other types of calcium-dependent or voltage-dependent K+ channels. Iberiotoxin is a valuable tool to study specifically Maxi-K channels.

Product Specifications

CAS Number

129203-60-7

Specifications

Blocker of high conductance Ca2+-activated K+ channel

Target

K channels

Sequence

FTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ

Peptide Number

12IBX001

Disulfide Bonds

Cys7-Cys28; Cys13-Cys33; Cys17-Cys35

N Terminal Sequence

PQ

C Terminal Sequence

OH

More Discoveries

Explore Other Products

Browse additional items from our catalog

URB2 Blocking Peptide
MBS9632764-01 1 mg

URB2 Blocking Peptide

Sign In for Pricing
View Details
URB2 Blocking Peptide
MBS9632764-02 5x 1 mg

URB2 Blocking Peptide

Sign In for Pricing
View Details
Mouse Eif4b qPCR Primer Pair
QM07470S 200 Tests

Mouse Eif4b qPCR Primer Pair

Sign In for Pricing
View Details
Connexin 43 (phospho Ser265) Polyclonal Antibody
MBS8520223-01 0.1 mg

Connexin 43 (phospho Ser265) Polyclonal Antibody

Sign In for Pricing
View Details
Connexin 43 (phospho Ser265) Polyclonal Antibody
MBS8520223-02 0.1 mL (AF635)

Connexin 43 (phospho Ser265) Polyclonal Antibody

Sign In for Pricing
View Details
Connexin 43 (phospho Ser265) Polyclonal Antibody
MBS8520223-03 0.1 mL (AF610)

Connexin 43 (phospho Ser265) Polyclonal Antibody

Sign In for Pricing
View Details