Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Guangxitoxin-1E

Guangxitoxin-1E (GxTx-1E) was isolated from the venom of Chilobrachys jingzhao (Chinese earth tiger tarantula) . Guangxitoxin-1E was shown to block Kv2.1/KCNB1, Kv2.2/KCNB2 and Kv4.3/KCND3 channels without significant effect on Kv1.2/KCNA2, Kv1.3/KCNA3, Kv1.5/KCNA5, Kv3.2/KCNC2, Cav1.2/CACNA1C, Cav2.2/CACNA1B, Nav1.5/SCN5A, Nav1.7/SCN9A or Nav1.8/SCN10A channels. Guangxitoxin-1E inhibits Kv2.1 with an IC50 value of 1 nM and Kv2.2 with an IC50 value of 3 nM. Block of Kv4.3 occurs at 10-20 fold higher concentrations. Guangxitoxin-1E acts as a gating modifier since it shifts the voltage-dependence of Kv2.1 K+ currents towards depolarized potentials. In pancreatic beta-cells, Guangxitoxin-1E enhances glucose-stimulated insulin secretion by broadening the cell action potential and enhancing calcium oscillations.

Product Specifications

CAS Number

1233152-82-3

Specifications

Selective blocker of Kv2.1 and Kv2.2

Target

K channels

Sequence

EGECGGFWWKCGSGKPACCPKYVCSPKWGLCNFPMP

Peptide Number

11GUA002

Disulfide Bonds

Cys4-Cys19; Cys11-Cys24; Cys18-Cys31

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BC006419 AAV Vector (Human) (CMV)
13066101 1 µg

BC006419 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Tbx18 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3797107 1.0 µg DNA

Tbx18 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
NDUFB8 (NM_001284367) Human Untagged Clone
SC334152 10 µg

NDUFB8 (NM_001284367) Human Untagged Clone

Sign In for Pricing
View Details
Rabbit Polyclonal TRPV6 Antibody
NBP1-74138 100 µL

Rabbit Polyclonal TRPV6 Antibody

Sign In for Pricing
View Details
NHLRC3, CT (NHLRC3, NHL repeat-containing protein 3) (PE) discontinued
038964-PE 200 µL

NHLRC3, CT (NHLRC3, NHL repeat-containing protein 3) (PE) discontinued

Sign In for Pricing
View Details
Anti-human apoB mAbs (LDL 20/17), unconjugated
orb1532650 250 µg

Anti-human apoB mAbs (LDL 20/17), unconjugated

Sign In for Pricing
View Details