Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Guangxitoxin-1E

Guangxitoxin-1E (GxTx-1E) was isolated from the venom of Chilobrachys jingzhao (Chinese earth tiger tarantula) . Guangxitoxin-1E was shown to block Kv2.1/KCNB1, Kv2.2/KCNB2 and Kv4.3/KCND3 channels without significant effect on Kv1.2/KCNA2, Kv1.3/KCNA3, Kv1.5/KCNA5, Kv3.2/KCNC2, Cav1.2/CACNA1C, Cav2.2/CACNA1B, Nav1.5/SCN5A, Nav1.7/SCN9A or Nav1.8/SCN10A channels. Guangxitoxin-1E inhibits Kv2.1 with an IC50 value of 1 nM and Kv2.2 with an IC50 value of 3 nM. Block of Kv4.3 occurs at 10-20 fold higher concentrations. Guangxitoxin-1E acts as a gating modifier since it shifts the voltage-dependence of Kv2.1 K+ currents towards depolarized potentials. In pancreatic beta-cells, Guangxitoxin-1E enhances glucose-stimulated insulin secretion by broadening the cell action potential and enhancing calcium oscillations.

Product Specifications

CAS Number

1233152-82-3

Specifications

Selective blocker of Kv2.1 and Kv2.2

Target

K channels

Sequence

EGECGGFWWKCGSGKPACCPKYVCSPKWGLCNFPMP

Peptide Number

11GUA002

Disulfide Bonds

Cys4-Cys19; Cys11-Cys24; Cys18-Cys31

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNAPC4 (Small Nuclear RNA Activating Complex, Polypeptide 4, 190kD, OTTHUMP00000022583, FLJ13451, PTFalpha, SNAP190) (MaxLight 650)
207885-ML650 100 µL

SNAPC4 (Small Nuclear RNA Activating Complex, Polypeptide 4, 190kD, OTTHUMP00000022583, FLJ13451, PTFalpha, SNAP190) (MaxLight 650)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB536843 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
RGD1561734 3'UTR Luciferase Stable Cell Line
TU218447 1.0 mL

RGD1561734 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Canine Stem Cell Factor (SCF) ELISA kit
EIA06326Ca 1 Kit

Canine Stem Cell Factor (SCF) ELISA kit

Sign In for Pricing
View Details
Progerinin
HY-159834-01 5 mg

Progerinin

Sign In for Pricing
View Details
Progerinin
HY-159834-02 10 mg

Progerinin

Sign In for Pricing
View Details