Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dc1a

β-Diguetoxin-Dc1a (Dc1a) is a peptide which has been isolated from the desert bush spider Diguetia canities. Dc1a has demonstrated insecticidal properties by promoting the opening of German cockroach voltage-gated sodium (Nav) channels (BgNav1) without affecting human Nav channels.

Product Specifications

Specifications

Opening of German cockroach voltage-gated sodium (Nav) channels (BgNav1)

Target

Na channels

Sequence

AKDGDVEGPAGCKKYDVECDSGECCQKQYLWYKWRPLDCRCLKSGFFSSKCVCRDV

Peptide Number

DCA001

Disulfide Bonds

Cys12-Cys25; Cys19-Cys39; Cys24-Cys53; Cys41-Cys51

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dusp1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7529802 1.0 µg DNA

Dusp1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Mouse Vbp1 Pre-designed siRNA Set B
SI115848B 1 Each

Mouse Vbp1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Lymphocyte Expansion Molecule (LEXM) Antibody (Biotin)
abx316287-01 20 µg

Lymphocyte Expansion Molecule (LEXM) Antibody (Biotin)

Sign In for Pricing
View Details
Lymphocyte Expansion Molecule (LEXM) Antibody (Biotin)
abx316287-02 50 µg

Lymphocyte Expansion Molecule (LEXM) Antibody (Biotin)

Sign In for Pricing
View Details
Lymphocyte Expansion Molecule (LEXM) Antibody (Biotin)
abx316287-03 100 µg

Lymphocyte Expansion Molecule (LEXM) Antibody (Biotin)

Sign In for Pricing
View Details
Lymphocyte Expansion Molecule (LEXM) Antibody (Biotin)
abx316287-04 200 µg

Lymphocyte Expansion Molecule (LEXM) Antibody (Biotin)

Sign In for Pricing
View Details