Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dc1a

β-Diguetoxin-Dc1a (Dc1a) is a peptide which has been isolated from the desert bush spider Diguetia canities. Dc1a has demonstrated insecticidal properties by promoting the opening of German cockroach voltage-gated sodium (Nav) channels (BgNav1) without affecting human Nav channels.

Product Specifications

Specifications

Opening of German cockroach voltage-gated sodium (Nav) channels (BgNav1)

Target

Na channels

Sequence

AKDGDVEGPAGCKKYDVECDSGECCQKQYLWYKWRPLDCRCLKSGFFSSKCVCRDV

Peptide Number

DCA001

Disulfide Bonds

Cys12-Cys25; Cys19-Cys39; Cys24-Cys53; Cys41-Cys51

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUMO4 Antibody
56-558 400 µL

SUMO4 Antibody

Sign In for Pricing
View Details
Human Flt-3/Flk-2 MAb (Clone 1038615)
MAB8123-SP 25 µg

Human Flt-3/Flk-2 MAb (Clone 1038615)

Sign In for Pricing
View Details
PMS7 shRNA (h) Lentiviral Particles
sc-89465-V 200 µL

PMS7 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Ethyl 2-amino-3- (3-fluorophenyl) propanoate hydrochloride
HTA65451-01 100 mg

Ethyl 2-amino-3- (3-fluorophenyl) propanoate hydrochloride

Sign In for Pricing
View Details
Ethyl 2-amino-3- (3-fluorophenyl) propanoate hydrochloride
HTA65451-02 1 g

Ethyl 2-amino-3- (3-fluorophenyl) propanoate hydrochloride

Sign In for Pricing
View Details
Porcine Adenylate kinase isoenzyme 1,AK1 ELISA KIT
ELI-13572p 96 Tests

Porcine Adenylate kinase isoenzyme 1,AK1 ELISA KIT

Sign In for Pricing
View Details