Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Chlorotoxin

Chlorotoxin (Cltx) is a neurotoxin that was originally isolated from the venom of Leiurus quinquestriatus. Chlorotoxin is a specific ligand of glioma cells. Chlorotoxin binds to Cl– channels (small conductance epithelial chloride channels) in the brain and spinal cord and inhibits Cl– influx. Chlorotoxin most probably acts as a specific blocker, although residues both inside and outside of the pore region of the Cl– channels participate in chlorotoxin binding. It was demonstrated that chlorotoxin inhibits specifically the activity of matrix metalloproteinase-2 (MMP-2) without affecting MMP-1, MMP-3 and MMP-9. MMP-2 are upregulated in glioma cells and related cells making chlorotoxin a promising antitumoral drug and diagnosis tool.

Product Specifications

CAS Number

163515-35-3

Specifications

Selective blocker of small conductance chloride channels

Target

Cl channels

Sequence

MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR

Peptide Number

08CHL001

Disulfide Bonds

Cys2-Cys19; Cys5-Cys28; Cys16-Cys33; Cys20-Cys35

N Terminal Sequence

H

C Terminal Sequence

NH2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Progesterone (Pregn-4-ene-3,20-dione) discontinued
P9006-02J 100 µg

Progesterone (Pregn-4-ene-3,20-dione) discontinued

Sign In for Pricing
View Details
4-chloro-2-nitro-1- (8-quinolyloxy) benzene
XQB58305 250 mg

4-chloro-2-nitro-1- (8-quinolyloxy) benzene

Sign In for Pricing
View Details
PACSIN2 CRISPR/Cas9 KO Plasmid (m)
sc-423926 20 µg

PACSIN2 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
DTX3 Rabbit pAb, BF700 conjugated
orb2864309 100 µL

DTX3 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
LCN9 (N-Term) Rabbit pAb
MBS8551563-01 0.1 mL

LCN9 (N-Term) Rabbit pAb

Sign In for Pricing
View Details
LCN9 (N-Term) Rabbit pAb
MBS8551563-02 0.1 mL (AF405L)

LCN9 (N-Term) Rabbit pAb

Sign In for Pricing
View Details