Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aah-II

AaH-II was originally discovered from the venom of the scorpion Androctonus australis Hector and belongs to alpha-toxins. It is a 64 amino-acid peptide that comprises four disulfide bonds and structured according a beta1-alpha-beta2-beta3 scaffold. Iodinated AaH-II binds with a 3 nM affinity to axolemma from rat Central Nervous System (DeVries and Lazdunski, 1982) . In frog myelinated nerve fibres, AaH-II prolongs the inactivation time constants of the inward Na+ current and induces a persistent current component (Benoit & Dubois, 1986) . By these two effects combined, AaH-II causes prolonged action potentials and thereby decreased firing frequencies. These effects are susceptible to produce paralysis, cardiac arrhythmia and death, including in humans (Bosmans & Tytgat, 2007) . Concerning the selectivity, the reported EC50 values for slowing channel inactivation are 3 nM for rat Nav1.2 and 2 nM for rat Nav1.4 channels (Alami et al., 2003) . The EC50 value on Nav1.7 is 52 nM. At the functional level, AaH-II was shown to bind onto the voltage-sensor of domain IV to block fast inactivation by trapping a deactivated state. (Clairfeuille et al., 2019) . Smartox now proposes the synthetic version of AaH-II.

Product Specifications

Specifications

Slowing of Nav1.2, Nav1.4 and Nav1.7 channels' inactivation

Target

Na channels

Sequence

VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Peptide Number

AAH001

Disulfide Bonds

Cys1-Cys8; Cys2-Cys5; Cys3-Cys6; Cys4-Cys7

N Terminal Sequence

H

C Terminal Sequence

NH2

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGB4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G3]
TA808611AM 100 µL

HMGB4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G3]

Sign In for Pricing
View Details
SERPINA12 Antibody
MBS9409011-01 0.1 mL

SERPINA12 Antibody

Sign In for Pricing
View Details
SERPINA12 Antibody
MBS9409011-02 5x 0.1 mL

SERPINA12 Antibody

Sign In for Pricing
View Details
COTL1, CT (Coactosin-like Protein, CLP) (MaxLight 750) discontinued
C7904-53B-ML750 100 µL

COTL1, CT (Coactosin-like Protein, CLP) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Goat Casein kinase I isoform delta (CSNK1D) ELISA Kit
GTR10342999 96 Well

Goat Casein kinase I isoform delta (CSNK1D) ELISA Kit

Sign In for Pricing
View Details
Atp5sl sgRNA CRISPR Lentivector set (Mouse)
K3167601 3x 1.0 µg

Atp5sl sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details