Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tamapin

Tamapin is a peptide toxin isolated from the venom of the Indian red scorpion Mesobuthus Tamulus. Tamapin is amidated at its C-terminal tyrosine residue. Tamapin binds to small conductance Ca2+-activated K+ channels (SK channels) with high affinity and inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus as well as in cell lines expressing distinct SK channel subunits. Contrary to Apamin or Leiurotoxin-1 (Scyllatoxin), Tamapin is an excellent toxin to discriminate among SK channel subtypes because it presents different affinities for SK1 (42 nM), SK2 (24 pM) and SK3 (1.7 nM) channels. This toxin is also the most potent SK2 channel blocker characterized so far (IC50 for SK2 channels = 24 pM) .

Product Specifications

Specifications

Selective blocker of SK2 (KCa2.2) channels

Target

K channels

Sequence

AFCNLRRCELSCRSLGLLGKCIGEECKCVPY

Peptide Number

10TAM001

Disulfide Bonds

Cys3-Cys21; Cys8-Cys26; Cys12-Cys28

N Terminal Sequence

H

C Terminal Sequence

NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

General Angiotensin (1-7) ELISA Kit
EK3964 Inquire

General Angiotensin (1-7) ELISA Kit

Sign In for Pricing
View Details
Na+/K+-ATPase α2 Polyclonal Antibody
UB-GEN-15894 100 µL

Na+/K+-ATPase α2 Polyclonal Antibody

Sign In for Pricing
View Details
Fish Substance P Receptor ELISA Kit
MBS035868-01 48 Well

Fish Substance P Receptor ELISA Kit

Sign In for Pricing
View Details
Fish Substance P Receptor ELISA Kit
MBS035868-02 96 Well

Fish Substance P Receptor ELISA Kit

Sign In for Pricing
View Details
Fish Substance P Receptor ELISA Kit
MBS035868-03 5x 96 Well

Fish Substance P Receptor ELISA Kit

Sign In for Pricing
View Details
Fish Substance P Receptor ELISA Kit
MBS035868-04 10x 96 Well

Fish Substance P Receptor ELISA Kit

Sign In for Pricing
View Details