Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stromatoxin-1 (ScTx1)

Stromatoxin-1 (ScTx-1) has been isolated from the venom of the African tarentula Stromatopelma calceata.Stromatoxin-1 is a 34 amino-acid long peptide that belongs to the structural family of inhibitor cystine knot peptides reticulated by three disulfide bridges. It has an amidated C-terminus and bears strong homology with hanatoxin 1 (83%) .Stromatoxin-1 inhibits with high affinities Kv2.1 and Kv2.2, that encode delayed K+ channels (respectively, with IC50 of 12 and 21 nM) . The block is voltage-dependent and slowly reversible. Stromatoxin-1 is also a very sensitive inhibitor of Kv4.2, that encodes a transient K+ current (IC50 of 1.2 nM) . Here also, the block is voltage-dependent indicating that ScTx-1 acts as a gating modifier rather than a pore blocker. Reversibility is faster on Kv4.2 channels. In contrast, Stromatoxin-1 has no effect on Kv1.1, Kv1.2, Kv1.3, Kv1.4, Kv1.5, Kv1.6 or Kv3.4 channels. The toxin has also no effect on voltage-dependent Na+ and Ca2+ channels of cerebellar granule cells. Stromatoxin-1 was found to increase the spontaneous phasic contraction amplitude, muscle force and tone in isolated rat urinary bladder smooth muscle. It also enhances myogenic constriction in pressurized arterial segments.

Product Specifications

Specifications

Blocker of Kv2 channels

Target

K channels

Sequence

DCTRMFGACRRDSDCCPHLGCKPTSKYCAWDGTI

Peptide Number

SCT01

Disulfide Bonds

Cys2-Cys16; Cys9-Cys21; Cys15-Cys28

N Terminal Sequence

H

C Terminal Sequence

NH2

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIM2 Blocking Peptide
33R-2734 100 ug

AIM2 Blocking Peptide

Sign In for Pricing
View Details
LGI2 Protein Vector (Human) (pPB-C-His)
PV090758 500 ng

LGI2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
VPS35 (Vacuolar Protein Sorting-associated Protein 35, hVPS35, Maternal-embryonic 3, MEM3, Vesicle Protein Sorting 35, TCCCTA00141, PARK17) (MaxLight 750) discontinued
135278-ML750 100 µL

VPS35 (Vacuolar Protein Sorting-associated Protein 35, hVPS35, Maternal-embryonic 3, MEM3, Vesicle Protein Sorting 35, TCCCTA00141, PARK17) (MaxLight 750) discontinued

Sign In for Pricing
View Details
TFDP1 Protein Vector (Mouse) (pPM-C-His)
PV237789 500 ng

TFDP1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
4- (2-Furyl) -3-buten-2-one
OR6040-01 5 g

4- (2-Furyl) -3-buten-2-one

Sign In for Pricing
View Details
4- (2-Furyl) -3-buten-2-one
OR6040-02 25 g

4- (2-Furyl) -3-buten-2-one

Sign In for Pricing
View Details