Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATTO488-ProTx-II

ATTO488-ProTx-II is a fluorescently labeled ProTx-II, a famous Nav1.7 blocker. The wild type ProTx-II blocks Nav1.7  with an IC50 value of around 300 pM, Nav1.2, Nav1.5 and Nav1.6 with IC50 values of 41 nM, 79 nM and 26 nM respectively.ATTO488-ProTx-II has been tested and its biological activity has been validated.

Product Specifications

Specifications

Nav1.7 selective blocker

Target

Na channels

Sequence

YCQKWMWTCDSERKCCEGMVCRLWCKKKLW

Peptide Number

PTF004

Disulfide Bonds

Cys2-Cys16; Cys9-Cys21; Cys15-Cys25

N Terminal Sequence

ATTO488

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd59a CRISPRa sgRNA lentivector (set of three targets)(Mouse)
15556124 3x 1.0µg DNA

Cd59a CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Rabbit Polyclonal Sin1/MAPKAP1 Antibody [CoraFluor 1]
NB110-40424CL1 0.1 mL

Rabbit Polyclonal Sin1/MAPKAP1 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Reactive yellow 25
HY-D0691 1 Each

Reactive yellow 25

Sign In for Pricing
View Details
INTS2 (A-5) Alexa Fluor® 594
sc-514945 AF594 200 µg/mL

INTS2 (A-5) Alexa Fluor® 594

Sign In for Pricing
View Details
Ptges2 (NM_133783) Mouse Tagged ORF Clone Lentiviral Particle
MR205997L4V 200 µL

Ptges2 (NM_133783) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
BO 1341
HY-129805 1 Each

BO 1341

Sign In for Pricing
View Details