Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cy5-ProTx-I

Cy5-ProTx-I (Protoxin 1; β-theraphotoxin-Tp1a) is a fluorescently labeled ProTx-I that was originally isolated from the venom of Thrixopelma pruriens (Peruvian green velvet tarantula) . This toxin reversibly inhibits the tetrodotoxin (TTX) -resistant channel Nav1.8 (IC50 = 27 nM) and Nav1.2, Nav1.5 and Nav1.7 with IC50 values between 50 and 100 nM. Furthermore, ProTx-I shifts the voltage dependence activity of T-type Cav3.1 channels (IC50= 50 nM) without affecting the voltage dependence of inactivation. ProTx-I is a valuable tool to discriminate between Cav3.1 and Cav3.2. ProTx-I is also an antagonist of TRAP1.

Product Specifications

Specifications

Blocker of voltage-gated sodium channels and T-type Cav

Target

Na channels

Sequence

YCQKWMWTCDSERKCCEGMVCRLWCKKKLW

Peptide Number

PTF001

Disulfide Bonds

Cys2-Cys16; Cys9-Cys21; Cys15-Cys28

N Terminal Sequence

Cy5

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HID1 Overexpression Lysate (Native) - (Dry Ice)
NBL1-08231 0.1 mg

HID1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
20-hydroxy-4(Z),7(Z),10(Z),13(Z),16(Z),18(E)-docosahexaenoic acid
MBS394181-01 0.1 mg

20-hydroxy-4(Z),7(Z),10(Z),13(Z),16(Z),18(E)-docosahexaenoic acid

Sign In for Pricing
View Details
20-hydroxy-4(Z),7(Z),10(Z),13(Z),16(Z),18(E)-docosahexaenoic acid
MBS394181-02 5x 0.1 mg

20-hydroxy-4(Z),7(Z),10(Z),13(Z),16(Z),18(E)-docosahexaenoic acid

Sign In for Pricing
View Details
Protein Kinase A regµLatory subunit I alpha (PRKAR1A) Human siRNA Oligo Duplex (Locus ID 5573)
SR303731 1 Kit

Protein Kinase A regµLatory subunit I alpha (PRKAR1A) Human siRNA Oligo Duplex (Locus ID 5573)

Sign In for Pricing
View Details
Regenerating islet-derived protein 3-alpha
orb1637800-01 50 µg

Regenerating islet-derived protein 3-alpha

Sign In for Pricing
View Details
Regenerating islet-derived protein 3-alpha
orb1637800-02 100 µg

Regenerating islet-derived protein 3-alpha

Sign In for Pricing
View Details