Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cy5-ProTx-I

Cy5-ProTx-I (Protoxin 1; β-theraphotoxin-Tp1a) is a fluorescently labeled ProTx-I that was originally isolated from the venom of Thrixopelma pruriens (Peruvian green velvet tarantula) . This toxin reversibly inhibits the tetrodotoxin (TTX) -resistant channel Nav1.8 (IC50 = 27 nM) and Nav1.2, Nav1.5 and Nav1.7 with IC50 values between 50 and 100 nM. Furthermore, ProTx-I shifts the voltage dependence activity of T-type Cav3.1 channels (IC50= 50 nM) without affecting the voltage dependence of inactivation. ProTx-I is a valuable tool to discriminate between Cav3.1 and Cav3.2. ProTx-I is also an antagonist of TRAP1.

Product Specifications

Specifications

Blocker of voltage-gated sodium channels and T-type Cav

Target

Na channels

Sequence

YCQKWMWTCDSERKCCEGMVCRLWCKKKLW

Peptide Number

PTF001

Disulfide Bonds

Cys2-Cys16; Cys9-Cys21; Cys15-Cys28

N Terminal Sequence

Cy5

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine DLL4 (NP_001231347.1) VersaClone cDNA
RDC3117 10 µg

Porcine DLL4 (NP_001231347.1) VersaClone cDNA

Sign In for Pricing
View Details
NDC80 Antibody
orb848267 2 mg

NDC80 Antibody

Sign In for Pricing
View Details
Trim30a Antibody : FITC (OAPB00729-FITC)
OAPB00729-100UG-FITC 0.1 mg

Trim30a Antibody : FITC (OAPB00729-FITC)

Sign In for Pricing
View Details
c-Src Polyclonal Antibody
UB-GEN-14481 100 µL

c-Src Polyclonal Antibody

Sign In for Pricing
View Details
SOX2 Rabbit pAb
E45R18478N-100 100 µL

SOX2 Rabbit pAb

Sign In for Pricing
View Details
RBFOX2 Rabbit Polyclonal Antibody
orb2951377-01 50 µg

RBFOX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details