Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cy5-ProTx-I

Cy5-ProTx-I (Protoxin 1; β-theraphotoxin-Tp1a) is a fluorescently labeled ProTx-I that was originally isolated from the venom of Thrixopelma pruriens (Peruvian green velvet tarantula) . This toxin reversibly inhibits the tetrodotoxin (TTX) -resistant channel Nav1.8 (IC50 = 27 nM) and Nav1.2, Nav1.5 and Nav1.7 with IC50 values between 50 and 100 nM. Furthermore, ProTx-I shifts the voltage dependence activity of T-type Cav3.1 channels (IC50= 50 nM) without affecting the voltage dependence of inactivation. ProTx-I is a valuable tool to discriminate between Cav3.1 and Cav3.2. ProTx-I is also an antagonist of TRAP1.

Product Specifications

Specifications

Blocker of voltage-gated sodium channels and T-type Cav

Target

Na channels

Sequence

YCQKWMWTCDSERKCCEGMVCRLWCKKKLW

Peptide Number

PTF001

Disulfide Bonds

Cys2-Cys16; Cys9-Cys21; Cys15-Cys28

N Terminal Sequence

Cy5

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLIS3 Overexpression Lysate (Native) - (Dry Ice)
NBP2-08361 0.1 mg

GLIS3 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Brilliant Violet 711™ anti-mouse CD184 (CXCR4)
GT04963 50 µg

Brilliant Violet 711™ anti-mouse CD184 (CXCR4)

Sign In for Pricing
View Details
ATP5D Adenovirus (Rat)
12711056 1.0 mL

ATP5D Adenovirus (Rat)

Sign In for Pricing
View Details
Forkhead Box protein P3 (FOXP3) Human ELISA Kit
95482 96 Tests

Forkhead Box protein P3 (FOXP3) Human ELISA Kit

Sign In for Pricing
View Details
Magic™ Membrane Protein Human TLR4 (Toll like receptor 4) expressed in In vitro wheat germ expression system for Antibody Discovery
MP1369X Each

Magic™ Membrane Protein Human TLR4 (Toll like receptor 4) expressed in In vitro wheat germ expression system for Antibody Discovery

Sign In for Pricing
View Details
Human Soluble toll like receptor 6 ELISA kit
GTR10374681 96 Well

Human Soluble toll like receptor 6 ELISA kit

Sign In for Pricing
View Details